SecReT6
Protein ID: 339496162
SecReT6 ID453
T6SS typei1
Gene symbol-
Locus tagPSTAB_4085
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T6SS(s) in this replicon]
Location [Strand]4410376..4412967 [+]
ProductATPase
NoteTssH
UniProt IDF8H6P2
KEGG IDpsz:PSTAB_4085
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.90E-43, Aligned region: 206..226
AAA_2 [PF07724], Evalue: 1.90E-43, Aligned region: 597..762
AAA [PF00004], Evalue: 2.20E-19, Aligned region: 208..339
AAA [PF00004], Evalue: 2.20E-19, Aligned region: 602..720
AAA_5 [PF07728], Evalue: 9.80E-13, Aligned region: 208..228
AAA_5 [PF07728], Evalue: 9.80E-13, Aligned region: 305..338
AAA_5 [PF07728], Evalue: 9.80E-13, Aligned region: 458..517
AAA_5 [PF07728], Evalue: 9.80E-13, Aligned region: 601..720
AAA_16 [PF13191], Evalue: 1.50E-12, Aligned region: 185..225
AAA_16 [PF13191], Evalue: 1.50E-12, Aligned region: 252..286
AAA_16 [PF13191], Evalue: 1.50E-12, Aligned region: 424..512
AAA_16 [PF13191], Evalue: 1.50E-12, Aligned region: 572..625
AAA_16 [PF13191], Evalue: 1.50E-12, Aligned region: 666..695
AAA_16 [PF13191], Evalue: 1.50E-12, Aligned region: 756..842
ClpB_D2-small [PF10431], Evalue: 4.40E-10, Aligned region: 771..840
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 207..303
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 600..706
AAA_19 [PF13245], Evalue: 1.90E-05, Aligned region: 205..228
AAA_19 [PF13245], Evalue: 1.90E-05, Aligned region: 598..628
IstB_IS21 [PF01695], Evalue: 2.20E-05, Aligned region: 193..247
IstB_IS21 [PF01695], Evalue: 2.20E-05, Aligned region: 601..619
IstB_IS21 [PF01695], Evalue: 2.20E-05, Aligned region: 791..833
AAA_17 [PF13207], Evalue: 3.80E-05, Aligned region: 208..255
AAA_17 [PF13207], Evalue: 3.80E-05, Aligned region: 463..463
AAA_17 [PF13207], Evalue: 3.80E-05, Aligned region: 600..636
Sigma54_activat [PF00158], Evalue: 4.30E-05, Aligned region: 202..222
Sigma54_activat [PF00158], Evalue: 4.30E-05, Aligned region: 600..720
Clp_N [PF02861], Evalue: 5.00E-05, Aligned region: 35..72
Clp_N [PF02861], Evalue: 5.00E-05, Aligned region: 102..122
NACHT [PF05729], Evalue: 7.60E-05, Aligned region: 208..235
NACHT [PF05729], Evalue: 7.60E-05, Aligned region: 601..642
AAA_25 [PF13481], Evalue: 0.00019, Aligned region: 208..232
AAA_25 [PF13481], Evalue: 0.00019, Aligned region: 264..304
AAA_25 [PF13481], Evalue: 0.00019, Aligned region: 598..633
AAA_18 [PF13238], Evalue: 0.00039, Aligned region: 208..228
AAA_18 [PF13238], Evalue: 0.00039, Aligned region: 602..643
AAA_29 [PF13555], Evalue: 0.00042, Aligned region: 202..225
AAA_29 [PF13555], Evalue: 0.00042, Aligned region: 599..626
ResIII [PF04851], Evalue: 0.00049, Aligned region: 190..228
ResIII [PF04851], Evalue: 0.00049, Aligned region: 278..289
ResIII [PF04851], Evalue: 0.00049, Aligned region: 573..634
Arch_ATPase [PF01637], Evalue: 0.0021, Aligned region: 188..222
Arch_ATPase [PF01637], Evalue: 0.0021, Aligned region: 260..291
Arch_ATPase [PF01637], Evalue: 0.0021, Aligned region: 600..613
Arch_ATPase [PF01637], Evalue: 0.0021, Aligned region: 672..682
DUF258 [PF03193], Evalue: 0.0034, Aligned region: 175..225
DUF258 [PF03193], Evalue: 0.0034, Aligned region: 600..612
AAA_14 [PF13173], Evalue: 0.0067, Aligned region: 208..311
AAA_14 [PF13173], Evalue: 0.0067, Aligned region: 600..695
SRP54 [PF00448], Evalue: 0.0094, Aligned region: 208..229
SRP54 [PF00448], Evalue: 0.0094, Aligned region: 600..622
Protein Sequence: 863 a.a.     [Download]
>gi|339496162|ref|YP_004716455.1| ATPase [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MINVDLQQLVQALDAPSKQDLEGAAERCVVRGGSKVLVEDLLLGLLERPDGLLKRALLDAEVDTGALAQA
LQPRGERSESRNPVFSTELVQWLQDALLVASLELGQSQIDQAALILALLRNPLRYAGSHYQPLLARLDAE
RLRDFALSQQPQGSTGKPAAGGESNLARFTHNFTQQARDGKLDPVLCRDSAIRQMIDILARRRKNNPIVV
GEAGVGKTAIVEGLALRIVSGEVPAALKGVELLCLDLGLLQAGASVKGEFERRLQGVIDEVKGSAKPIIL
FIDEAHTLIGAGGQAGSGDAANLLKPALARGELRTIAATTWSEYKKYFEKDPALARRFQPVQLHEPSVPE
AVTILRGLAPVYEKSHGIYLRDDAVTAAAELSARYLAGRQLPDKAVDVLDTACARVRISLAAAPEALERL
RGEVAEGERQREAMRRDLAAGLPVDAAVLQRLEQRLLTAGDEIEQLESRWTRQRQLAERLLELRKRTAEA
RSDANEDGEAPSLDELESELRAVQAELAIAQAEQRLVSHEVCPRLVAEVISHWTGVPLTQLAREHNAQVA
NFAADLRARVRGQEQAVEALDRAMRAAAAGLNKPDAPVGVFLLVGPSGVGKTETALALADLLYGGERFLT
VINMSEFQEKHSVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVILLDEVEKADPDVMNVFYQIFDKGVAN
DGEGREINFRNTLILMTSNLASERIASFCTAGQRPAAEDLELAIRPQLSQHFKPALLGRMRVVPYYPIIG
EVLDELVALKLARFGERLQRRQLQFSHCPALVTHLAERCSDSDSGARLIDHLIEQHLQPLVVDRLLDAMA
SGEPLQRVHATLDGEGTLVCEFA
 
Nucleotide Sequence: 2592 bp     [Download]
>gi|339492077|ref|NC_015740.1|:4410376-4412967 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGATCAACGTCGACTTACAGCAACTGGTGCAAGCCCTGGATGCCCCCAGTAAACAGGATCTGGAGGGCG
CAGCCGAACGCTGCGTGGTACGTGGCGGCAGCAAGGTTCTCGTCGAGGACCTGCTGCTCGGCCTGCTCGA
GCGTCCCGATGGACTGCTCAAGCGAGCCTTGCTGGATGCCGAAGTCGATACCGGCGCACTGGCGCAGGCG
CTGCAACCGCGAGGCGAGCGCAGCGAATCGCGCAACCCGGTGTTTTCCACAGAACTGGTGCAATGGCTAC
AGGATGCCCTGCTGGTGGCCAGCCTGGAACTCGGCCAGAGCCAGATCGACCAGGCCGCACTGATTCTCGC
GCTGCTGCGCAATCCGCTGCGCTATGCAGGCAGTCATTACCAGCCATTGCTGGCCCGGCTGGATGCCGAG
CGCCTGCGCGACTTCGCCCTAAGCCAGCAGCCTCAAGGCAGCACTGGCAAACCTGCTGCCGGTGGCGAGT
CGAACCTGGCGCGCTTTACCCACAACTTCACCCAACAGGCCCGTGACGGCAAGCTCGATCCGGTGCTCTG
CCGCGACTCGGCGATCCGCCAGATGATCGACATCCTCGCCCGGCGGCGAAAGAACAATCCGATCGTGGTC
GGCGAAGCTGGGGTCGGCAAGACCGCCATCGTCGAAGGCCTGGCGCTGCGCATCGTCAGCGGGGAAGTGC
CTGCGGCGCTGAAGGGCGTCGAGCTGCTCTGCCTGGACCTCGGCCTGCTGCAAGCCGGTGCCAGCGTGAA
GGGCGAATTCGAACGCCGCTTGCAGGGCGTGATCGACGAGGTGAAAGGCTCAGCCAAGCCGATCATCCTG
TTTATCGACGAGGCGCACACGCTGATTGGCGCCGGCGGCCAGGCCGGTAGCGGCGATGCGGCCAACCTGC
TCAAGCCGGCACTGGCACGCGGCGAGCTGCGCACCATCGCTGCAACGACCTGGAGCGAGTACAAGAAATA
CTTCGAGAAGGACCCGGCACTGGCCCGGCGCTTCCAGCCGGTGCAGCTGCACGAGCCGAGCGTTCCGGAA
GCCGTCACCATCCTGCGCGGGCTGGCGCCGGTCTACGAAAAAAGTCACGGCATCTACCTGCGCGATGATG
CGGTCACGGCCGCCGCCGAGCTGTCGGCGCGCTACCTGGCCGGCCGGCAGCTGCCGGACAAGGCCGTCGA
CGTGCTGGATACCGCCTGCGCGCGGGTGCGCATCAGCCTCGCCGCTGCGCCCGAGGCGCTGGAACGCCTG
CGTGGTGAGGTCGCCGAAGGCGAGCGCCAGCGTGAAGCCATGCGCCGCGATCTGGCCGCCGGCCTGCCGG
TCGACGCGGCTGTCCTCCAGCGGCTGGAGCAACGTCTGCTCACGGCGGGAGACGAAATCGAGCAGCTCGA
ATCCCGCTGGACCAGGCAGCGCCAGCTCGCCGAGCGCCTGCTCGAGCTGCGCAAACGCACCGCCGAAGCC
CGCAGCGATGCAAACGAGGACGGCGAGGCCCCATCGCTCGATGAGCTCGAGTCCGAGCTACGCGCCGTAC
AGGCCGAACTCGCCATAGCCCAGGCCGAGCAGCGACTGGTCAGCCATGAGGTCTGCCCGCGCCTGGTGGC
CGAGGTGATCAGCCACTGGACCGGTGTGCCGCTGACGCAGCTGGCTCGGGAGCACAACGCCCAGGTCGCC
AACTTCGCCGCCGATCTGCGCGCCCGGGTGCGCGGTCAGGAACAGGCCGTGGAAGCGCTGGATCGTGCCA
TGCGCGCGGCAGCGGCCGGGTTGAACAAGCCCGACGCTCCGGTGGGCGTGTTCCTGCTGGTCGGCCCCAG
CGGCGTCGGCAAGACCGAGACCGCCCTTGCCCTGGCCGACCTGCTGTATGGCGGCGAGCGCTTCCTCACC
GTGATCAACATGTCCGAGTTCCAGGAGAAACACAGCGTTTCCCGCCTGATCGGCGCGCCTCCAGGCTATG
TCGGCTACGGCGAAGGCGGCATGCTCACCGAAGCGGTGCGGCAGAAACCCTACTCGGTGATCCTGCTCGA
CGAGGTGGAGAAGGCCGATCCCGATGTGATGAATGTCTTCTATCAGATCTTCGACAAGGGCGTGGCGAAT
GACGGCGAAGGCCGCGAGATCAACTTCCGCAACACCCTGATCCTGATGACCAGCAATCTCGCCAGCGAGC
GCATCGCCAGTTTCTGCACCGCCGGACAGCGACCGGCGGCCGAGGATCTGGAACTGGCCATCCGTCCGCA
GCTGTCGCAGCACTTCAAGCCGGCCCTGCTCGGGCGCATGCGTGTGGTGCCCTACTACCCGATCATCGGC
GAAGTGCTCGACGAGCTGGTCGCGCTCAAGCTGGCACGCTTCGGTGAGCGGTTGCAGCGTCGCCAGCTGC
AGTTCAGCCACTGCCCGGCGCTGGTCACGCACCTCGCCGAGCGCTGCAGCGACAGCGACAGCGGTGCGCG
CCTGATCGACCACCTGATCGAGCAGCACCTGCAACCGCTGGTGGTGGACCGCCTGCTCGATGCCATGGCC
AGTGGCGAGCCGCTGCAGCGGGTACATGCCACGCTGGATGGCGAGGGTACACTGGTCTGTGAGTTCGCCT
GA