SecReT6
Protein ID: 339496164
SecReT6 ID453
T6SS typei1
Gene symbol-
Locus tagPSTAB_4087
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T6SS(s) in this replicon]
Location [Strand]4414502..4416601 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDF8H6P4
KEGG IDpsz:PSTAB_4087
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.60E-72, Aligned region: 29..323
Phage_GPD [PF05954], Evalue: 5.60E-72, Aligned region: 522..544
Phage_base_V [PF04717], Evalue: 1.20E-24, Aligned region: 371..464
Protein Sequence: 699 a.a.     [Download]
>gi|339496164|ref|YP_004716457.1| Rhs element Vgr protein [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MFNPANQAHFTLSLEGVEHDFKVLEFRGREAISQPYRFDLELVSERPDLDLQSLLHRPAFLAFAPDGSGV
HGLVHQAAQGESGKRLTRYRLTLVPQLAYLAHRTNQRIFQHLTVPQIIAQVLEEHGIQADAYRFGLGPVV
YPPREYCVQYDETDLHFIQRLCEEEGIHYHFQHAASGHVLVFGDDQTVFPRLTATAYQRDSGLVADQPVI
KRFGLRVETRTSRVTRRDYDFEKPRLTMEAAFHSDFQPDLEDYDYPGRFTERARGKHLSQRALERHRHDY
ELAEGESDQPKLVSGHFLPLTEHPRSDWNQLWLLTEVLHEGKQPQVLEEAVTSHVDSGDGFVQGYRNRFS
ATPWAIPFRPALRHPKPKVLGSQTAVVTGPAGEEIHCDEYGRVKVQFYWDREAQADDKTSCWLRVSSSWA
GDRYGGIAIPRVGMEVLVTFLEGDPDQPLVTGCLYHKEHQVPYDLPANKTRTVFKTLSSPGGGGYNELRI
EDRKGAEQIYLHAQRDWDENIEHDQKIRVGHERHDTVEANSYSEFRAEEHRTTHADRKTEIRANDHLTVG
NSQHLKIGTGKFIEAGNEIHYYAGSKVVIDAGMELTASGGGSFLKLDPSGVTLSGATIRMNSGGAAGKGS
GLKILAPVMPWLATSAVAGNLTLPALINMSQQLKLAAAAKLLLVKQCGMRADGSCQLEVCPCGKNASTV
 
Nucleotide Sequence: 2100 bp     [Download]
>gi|339492077|ref|NC_015740.1|:4414502-4416601 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGTTCAACCCAGCCAACCAGGCCCACTTCACGCTTTCCCTCGAAGGCGTCGAGCACGACTTCAAGGTGC
TCGAATTCCGGGGCCGTGAAGCCATCAGCCAGCCCTATCGCTTCGACCTGGAACTGGTCAGCGAGCGCCC
CGACCTGGATCTGCAAAGCCTGCTGCATCGCCCGGCTTTTCTTGCCTTCGCGCCGGATGGCAGTGGTGTT
CATGGGCTGGTGCATCAGGCCGCCCAGGGTGAATCCGGCAAGCGCCTGACCCGCTATCGCCTCACGCTGG
TGCCGCAACTGGCCTACCTCGCCCATCGCACCAACCAGCGCATCTTCCAGCACCTGACGGTGCCGCAGAT
CATCGCCCAGGTGCTCGAAGAGCATGGTATCCAAGCCGATGCCTACCGCTTCGGGCTTGGCCCGGTGGTC
TACCCGCCGCGCGAGTACTGCGTGCAGTACGACGAAACCGACCTGCACTTCATCCAGCGCCTGTGCGAGG
AAGAGGGCATCCACTATCACTTCCAGCACGCTGCGAGCGGCCATGTGCTGGTCTTCGGCGATGACCAGAC
CGTCTTCCCCAGGCTCACCGCCACCGCCTATCAACGGGACAGCGGTCTGGTCGCCGACCAACCGGTGATC
AAGCGCTTCGGCCTGCGTGTGGAAACCCGTACCAGCCGGGTCACGCGCCGCGATTACGATTTCGAGAAGC
CACGCCTGACCATGGAGGCCGCGTTCCACAGCGATTTCCAGCCGGACCTCGAGGACTACGACTACCCCGG
CCGCTTCACCGAGCGCGCCCGCGGCAAGCATCTGTCGCAGCGCGCCCTGGAGCGCCACCGCCACGATTAC
GAACTGGCCGAAGGCGAAAGCGACCAGCCCAAGCTGGTGAGTGGCCATTTCCTCCCGCTCACCGAACACC
CGCGCAGCGACTGGAACCAGCTCTGGCTACTTACCGAAGTGCTGCACGAAGGAAAACAGCCGCAGGTGTT
GGAGGAGGCCGTCACCAGTCATGTCGATAGCGGTGACGGCTTCGTCCAGGGCTACCGCAACCGCTTCAGC
GCCACCCCCTGGGCCATCCCCTTCCGCCCGGCGCTTCGCCATCCGAAACCGAAGGTGCTCGGCAGCCAGA
CCGCCGTGGTTACCGGCCCCGCTGGCGAAGAGATCCACTGCGACGAGTACGGCCGCGTAAAAGTCCAGTT
CTACTGGGACCGCGAAGCCCAGGCCGATGACAAGACCAGCTGCTGGCTGCGCGTCAGCTCCAGCTGGGCG
GGTGACCGCTATGGCGGCATCGCCATCCCGCGGGTCGGCATGGAAGTGCTGGTGACCTTCCTCGAAGGCG
ATCCCGATCAACCGCTGGTGACCGGCTGCCTGTACCACAAGGAGCATCAGGTCCCCTACGACCTGCCGGC
CAACAAGACCCGCACGGTGTTCAAGACCCTGAGCAGCCCGGGTGGTGGCGGCTACAACGAACTGCGCATC
GAAGACCGCAAGGGCGCCGAACAGATCTACCTCCACGCCCAGCGCGACTGGGACGAGAACATCGAGCACG
ACCAGAAGATCCGCGTCGGCCACGAACGCCACGACACGGTGGAAGCCAACAGCTACAGCGAGTTCCGCGC
CGAAGAACACCGCACCACCCACGCCGACCGCAAGACCGAAATCCGCGCCAACGACCACCTCACCGTGGGC
AACAGCCAGCACCTGAAGATCGGCACCGGAAAATTCATAGAGGCGGGCAATGAAATCCACTACTACGCCG
GCAGCAAGGTCGTCATCGACGCAGGAATGGAACTCACCGCCTCAGGCGGCGGCAGTTTCCTCAAGCTCGA
CCCCAGCGGGGTGACGCTGAGCGGTGCGACGATCCGGATGAATTCGGGTGGCGCAGCCGGAAAGGGCTCG
GGGCTGAAGATTCTGGCGCCGGTGATGCCATGGTTGGCGACCAGCGCCGTTGCCGGCAACCTCACCTTGC
CTGCCTTGATCAACATGTCGCAGCAACTCAAACTGGCCGCGGCCGCCAAGCTGCTGCTGGTCAAGCAATG
CGGAATGCGAGCCGATGGCTCATGCCAGTTGGAGGTTTGCCCATGCGGCAAGAACGCGAGCACGGTCTGA