SecReT6
Protein ID: 339999220
SecReT6 ID454
T6SS typei4a
Gene symbol-
Locus tagSBG_1233
StrainSalmonella bongori NCTC 12419
Repliconchromosome [GenBank: NC_015761] [Browse all T6SS(s) in this replicon]
Location [Strand]1350271..1351197 [-]
Producttype VI secretion protein ImpA
NoteTssA
UniProt IDF8VIF9
KEGG IDsbg:SBG_1233
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.40E-17, Aligned region: 55..114
ImpA-rel_N [PF06812], Evalue: 9.40E-17, Aligned region: 185..200
Protein Sequence: 308 a.a.     [Download]
>gi|339999220|ref|YP_004730103.1| type VI secretion protein ImpA [Salmonella bongori NCTC 12419]
MMEAIETLLTPVSPEHPCGESVRYSPEFDRLAAARQQDDETLPTGVWQSTPRRADWEEVARLACELTLSR
SKDLVIMSWLGEAWLHLRGLVALPDALSLLALALERYPNELHPQIKDDDYDYRAAPLCWVAQHYAAMVAN
APLFTCEEETISLAQWQQGKRHDLPPPEMQANIGLALTASLKWLQRLTDLCQNWPDATAPSFNVLEQKIK
TCQQALGHSVTERPQSEAGETQISAATNSPAFASREEAYQMLKQIADYLQRTEPHSPVPYLLHRACIWGH
TPLPELLNELLVSDEAARQLWRQLGVLP
 
Nucleotide Sequence: 927 bp     [Download]
>gi|339998036|ref|NC_015761.1|:c1351197-1350271 Salmonella bongori NCTC 12419, complete genome
ATGATGGAAGCTATAGAGACGCTACTGACGCCTGTCAGCCCGGAGCATCCTTGTGGAGAATCGGTACGCT
ACTCGCCGGAATTCGACCGGCTGGCGGCGGCGCGGCAACAGGATGATGAAACTCTGCCGACCGGCGTCTG
GCAAAGCACGCCGCGACGCGCCGATTGGGAAGAGGTCGCCCGGCTGGCCTGCGAGTTAACGCTATCGCGC
AGTAAAGATCTGGTGATTATGAGCTGGCTGGGGGAAGCCTGGTTACACCTGCGCGGTCTGGTGGCGCTGC
CCGACGCGCTGTCCCTGCTGGCGCTGGCGCTGGAGCGCTACCCGAACGAGCTACATCCACAAATTAAGGA
TGACGATTACGATTATCGCGCTGCCCCACTCTGCTGGGTAGCGCAGCATTATGCCGCGATGGTTGCTAAC
GCGCCGCTGTTTACCTGCGAGGAGGAAACCATCTCGCTGGCGCAATGGCAACAGGGAAAACGCCACGATC
TCCCTCCCCCTGAAATGCAGGCCAATATTGGTCTGGCCCTAACGGCGAGCCTGAAGTGGCTGCAGCGCCT
TACCGATCTTTGCCAGAACTGGCCTGACGCAACTGCCCCCTCTTTCAATGTGCTGGAGCAGAAAATTAAA
ACCTGTCAACAGGCGCTGGGACATAGCGTCACTGAACGTCCACAGTCGGAAGCCGGAGAAACGCAAATAT
CTGCGGCGACGAACTCGCCGGCATTCGCCAGCCGTGAAGAGGCCTACCAGATGCTTAAACAGATTGCGGA
CTACCTGCAGCGTACGGAACCCCATAGTCCGGTGCCTTATCTGCTACATCGCGCCTGTATATGGGGACAT
ACGCCGTTACCAGAGTTACTTAACGAATTGCTCGTCAGCGATGAAGCCGCCCGCCAGCTCTGGCGGCAAC
TGGGGGTGTTACCATGA