SecReT6
Protein ID: 339999222
SecReT6 ID454
T6SS typei4a
Gene symbol-
Locus tagSBG_1235
StrainSalmonella bongori NCTC 12419
Repliconchromosome [GenBank: NC_015761] [Browse all T6SS(s) in this replicon]
Location [Strand]1354744..1355490 [-]
Producttype VI secretion protein DotU
NoteTssL
UniProt IDF8VIG1
KEGG IDsbg:SBG_1235
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.90E-24, Aligned region: 47..218
Protein Sequence: 248 a.a.     [Download]
>gi|339999222|ref|YP_004730105.1| type VI secretion protein DotU [Salmonella bongori NCTC 12419]
MPVNPDMPACRLFDDIFSRWLTQFEQWKRITLPPEALHQLAFDYSNQTVADYSRRLTRELGTPFKQHIDA
AIYALVALLDETVLYSDWPALSWWQDCPLEYHLWQTHSAGDQFPAHIQALLNERNPAQRDLAALYLRCLT
LGFGVKRDNFDEQAHQETCRLLWHFAFQEEAQMSGIAQKLNADSLASPLQLPPRRRLPDNSRLHLIAFIV
LLTLLLLSQRLWLSIEDAIGVSTLPNFPVTQYCEGDRS
 
Nucleotide Sequence: 747 bp     [Download]
>gi|339998036|ref|NC_015761.1|:c1355490-1354744 Salmonella bongori NCTC 12419, complete genome
ATGCCTGTTAATCCAGATATGCCCGCCTGCCGGTTATTTGACGACATTTTTTCCCGCTGGCTGACCCAAT
TTGAGCAATGGAAGCGCATCACCCTGCCTCCTGAAGCGCTGCACCAGTTAGCTTTCGACTACAGTAATCA
GACTGTCGCCGATTATAGCCGACGCCTGACCCGTGAACTGGGCACGCCCTTTAAGCAGCATATTGATGCC
GCGATTTATGCGCTGGTAGCGCTGCTCGATGAAACCGTTCTTTATAGCGACTGGCCTGCACTTAGCTGGT
GGCAGGACTGCCCGCTGGAATACCATCTCTGGCAAACTCACAGCGCTGGCGACCAGTTTCCCGCTCATAT
TCAGGCACTGCTGAATGAACGCAACCCTGCGCAACGCGATCTGGCGGCCCTTTATCTGCGCTGCCTGACG
CTGGGCTTTGGTGTCAAACGTGACAACTTCGACGAACAAGCCCATCAGGAGACCTGCCGTTTGCTATGGC
ATTTTGCTTTTCAGGAAGAGGCGCAAATGTCGGGCATCGCGCAAAAGCTCAATGCCGACTCGCTGGCGTC
GCCTTTGCAGCTTCCTCCCCGCCGCCGCCTTCCGGACAATTCCCGTCTGCATCTGATCGCCTTCATTGTG
CTACTGACGCTGTTGTTACTAAGCCAACGGCTGTGGCTGAGTATTGAAGATGCCATTGGCGTCAGCACTC
TGCCCAACTTTCCAGTGACGCAGTATTGCGAGGGAGATAGATCGTGA