SecReT6
Protein ID: 339999223
SecReT6 ID454
T6SS typei4a
Gene symbol-
Locus tagSBG_1236
StrainSalmonella bongori NCTC 12419
Repliconchromosome [GenBank: NC_015761] [Browse all T6SS(s) in this replicon]
Location [Strand]1355480..1356811 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDF8VIG2
KEGG IDsbg:SBG_1236
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-58, Aligned region: 20..387
Protein Sequence: 443 a.a.     [Download]
>gi|339999223|ref|YP_004730106.1| type VI secretion protein [Salmonella bongori NCTC 12419]
MNTIPAMVCWYEGMAMLPQHFQLQALRHEMLTATLARCANPWFWGVMRLEIDEAALCAGTLRVMQLQAIM
PDGVPINYDISRDPPLEFDCARLLPASPDSEHTLWLALSPASRAGQWQLMNTRYRSVNSAPLPDLTSGEF
PQSVPLWQPMPHLVSQHERADFICLPLIQVVYSEGGFRRNEWFAPMPALEHESYPWRHARQICLQAREKI
LFLNREIQLARQNQRTTDGLWLTLSLQSLQGGLVFLESLLNSGHVHPVDLYRALCLFAGQTAILTQEKTL
PLLPEFDYLDMYAAFTSLFALLRNQLAHIHRRWQRLNFNRQENSFTLTLPAGIRAGDQIIIGVLMPNGCT
MPAQSWLQQSIIASQPFLAVLRRQRMHGMTISPLPAERRSDWEIDNSITLFTLTLVTNWFEKETPLIISP
LHETDSIPERIMLYRQEDHYDAC
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|339998036|ref|NC_015761.1|:c1356811-1355480 Salmonella bongori NCTC 12419, complete genome
ATGAATACAATTCCTGCTATGGTCTGCTGGTACGAAGGAATGGCAATGCTGCCGCAGCACTTTCAACTAC
AAGCGCTACGCCATGAAATGCTTACAGCAACCCTGGCGCGCTGCGCCAATCCCTGGTTCTGGGGCGTGAT
GCGGCTGGAAATCGACGAGGCGGCATTATGCGCGGGAACCTTACGCGTTATGCAACTGCAGGCGATAATG
CCGGACGGAGTGCCCATCAATTACGATATAAGCCGCGATCCGCCGCTGGAATTCGACTGCGCCAGGCTGT
TGCCCGCCTCCCCGGATAGCGAACATACGTTATGGCTGGCGCTGTCGCCCGCCAGCCGCGCCGGACAGTG
GCAGCTAATGAATACCCGATATCGCTCGGTAAATAGCGCACCATTACCCGACTTAACCAGCGGCGAATTT
CCGCAAAGTGTTCCACTCTGGCAACCGATGCCACACCTGGTGAGCCAGCATGAGCGCGCCGATTTCATCT
GTTTGCCGCTGATTCAGGTGGTCTATAGCGAAGGAGGATTTCGCCGCAATGAGTGGTTCGCACCGATGCC
TGCGCTGGAGCACGAGAGCTACCCCTGGCGCCACGCCCGACAGATATGCCTTCAGGCCCGGGAGAAAATC
CTTTTTCTCAACCGCGAAATCCAGTTGGCCCGGCAGAATCAAAGAACGACAGACGGGCTGTGGTTAACCC
TATCGCTGCAAAGTCTTCAGGGCGGTCTTGTGTTTCTTGAATCGTTGCTTAACAGCGGGCACGTACACCC
TGTCGATCTTTACCGCGCGCTCTGTTTGTTCGCCGGGCAAACGGCCATCTTAACCCAGGAGAAAACTCTG
CCGTTGCTGCCTGAGTTTGATTACCTGGATATGTACGCGGCGTTTACCTCGCTTTTTGCTCTGCTGCGCA
ATCAACTGGCACATATTCATCGCCGCTGGCAACGCCTTAATTTCAACCGACAGGAAAATAGCTTTACCCT
GACGCTACCTGCCGGCATCCGTGCGGGCGATCAGATCATTATCGGCGTATTAATGCCGAACGGCTGTACG
ATGCCGGCGCAGAGCTGGCTTCAGCAAAGCATTATCGCCAGCCAGCCGTTTTTAGCGGTTTTACGCCGCC
AGCGGATGCATGGCATGACCATTTCGCCACTACCGGCAGAGCGGCGTAGCGACTGGGAAATTGATAATAG
CATCACGCTGTTTACCCTTACCCTGGTCACTAACTGGTTTGAAAAGGAAACACCGCTGATTATTTCGCCG
CTGCATGAGACCGACAGTATACCGGAGCGGATCATGCTTTACCGCCAGGAGGACCATTACGATGCCTGTT
AA