SecReT6
Protein ID: 339999225
SecReT6 ID454
T6SS typei4a
Gene symbol-
Locus tagSBG_1238
StrainSalmonella bongori NCTC 12419
Repliconchromosome [GenBank: NC_015761] [Browse all T6SS(s) in this replicon]
Location [Strand]1357614..1358165 [+]
Producthypothetical protein
NoteTssB
UniProt IDF8VIG4
KEGG IDsbg:SBG_1238
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.60E-55, Aligned region: 22..174
Protein Sequence: 183 a.a.     [Download]
>gi|339999225|ref|YP_004730108.1| hypothetical protein SBG_1238 [Salmonella bongori NCTC 12419]
MHQEYYCDKKGLNMAESIQHKLNRIRPPRVQITYDVETGGAIEKKELPLVVGILADLSGQPATPPEKLRE
RRFVEIDRDNFDDVLASIAPRLALQVENRLANDGSKFNIELNFKTFEDFSPRNIIDQVKPLQRLFLARQR
LRDLLTKLDGNDDLDALLQQVINDNAELQALRPAAAERPAENA
 
Nucleotide Sequence: 552 bp     [Download]
>gi|339998036|ref|NC_015761.1|:1357614-1358165 Salmonella bongori NCTC 12419, complete genome
ATGCACCAGGAATACTATTGCGATAAAAAAGGATTGAATATGGCAGAGAGCATTCAGCATAAACTTAATC
GTATTAGGCCGCCGCGAGTACAAATCACCTATGATGTGGAAACCGGCGGGGCGATTGAGAAAAAAGAACT
TCCGTTAGTGGTGGGTATACTGGCGGATTTATCCGGGCAGCCTGCGACCCCGCCAGAAAAATTACGAGAG
CGCCGTTTTGTCGAAATCGATCGGGATAACTTTGATGATGTGCTTGCTTCAATAGCGCCCCGTCTGGCGC
TGCAGGTTGAAAACCGGCTGGCGAACGATGGCAGTAAATTTAATATTGAGCTCAACTTCAAAACCTTTGA
AGACTTTTCTCCCCGCAACATTATCGATCAGGTTAAGCCCCTCCAGCGCTTATTTCTGGCGCGGCAGCGC
CTGCGCGATCTGCTCACTAAACTGGATGGTAATGATGATTTGGACGCGTTGTTGCAACAGGTCATCAACG
ACAATGCCGAACTTCAGGCACTGCGCCCGGCCGCAGCAGAACGTCCGGCCGAAAACGCGTAA