SecReT6
Protein ID: 339999226
SecReT6 ID454
T6SS typei4a
Gene symbol-
Locus tagSBG_1239
StrainSalmonella bongori NCTC 12419
Repliconchromosome [GenBank: NC_015761] [Browse all T6SS(s) in this replicon]
Location [Strand]1358186..1359667 [+]
Producttype VI secretion protein VipB
NoteTssC
UniProt IDF8VIG5
KEGG IDsbg:SBG_1239
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.70E-187, Aligned region: 66..488
Protein Sequence: 493 a.a.     [Download]
>gi|339999226|ref|YP_004730109.1| type VI secretion protein VipB [Salmonella bongori NCTC 12419]
MDNVQEHADTGGKTVTLSVLDRIIQEGRMARDELQQTYARDMLEELATQILDEGMSVDSDTVAMINHRIA
QIDELISAQLNDVLHHPDMQKLEASWRGLHQFVMNTETSTRLKLRLLNVSRNELQTDLEKAVEFDQSTLF
KKLYEDEYGTFGGNPYSVLVGDFEFGRHPQDVALLEKISQVAAAAHAPFIAAASPRLFDMGSFADLSVPR
DLAKIFESAELMKWRAFRESEDSRYVSLVLPHVLQRLPYGPDTVPVEGVNFVEDVDGMDASKYLWGNAAW
ALAGRITEAFALYGWCAAIRGVEGGGLVENLPAHTFSTPSGDISLRCPTEVAITDRREKELNDLGFIALC
HKKNSNTAAFFGGQTTNQAKIYNTPEANANARISAMLPYILAASRFAHYLKVIMRDKVGSFMSRDEVESY
LNNWIADYVLLTDSAPQEIKARYPLREARVDVSEVPGKPGVYRAVVFLRPHFQLEELTTSIRLVAELPPP
AAA
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|339998036|ref|NC_015761.1|:1358186-1359667 Salmonella bongori NCTC 12419, complete genome
ATGGATAATGTTCAGGAACACGCTGATACTGGCGGGAAAACGGTTACGCTGAGCGTACTGGATCGCATCA
TTCAGGAAGGCCGCATGGCGCGCGACGAGCTACAGCAGACCTACGCACGCGATATGCTCGAAGAGTTGGC
GACACAGATCCTGGATGAAGGGATGTCGGTGGACAGCGACACCGTGGCGATGATCAATCATCGTATCGCG
CAAATTGATGAGCTGATCAGCGCCCAGCTCAACGACGTGCTGCATCACCCTGATATGCAGAAACTGGAAG
CCTCATGGCGCGGGCTGCACCAGTTTGTGATGAATACGGAGACCAGCACCCGCCTGAAACTGCGTCTGCT
GAACGTTTCGCGCAACGAACTACAGACCGATCTTGAGAAAGCCGTCGAATTTGATCAGAGCACGCTGTTT
AAGAAGCTGTATGAGGATGAATACGGCACCTTCGGCGGCAACCCGTATAGCGTGCTGGTCGGCGATTTTG
AGTTTGGTCGTCATCCGCAGGATGTGGCGTTGCTGGAGAAAATTTCTCAGGTCGCAGCGGCGGCCCATGC
GCCTTTTATCGCCGCCGCCAGCCCACGGTTATTTGATATGGGATCGTTTGCCGATTTGAGCGTACCGCGC
GATTTGGCGAAAATTTTTGAGAGTGCTGAATTGATGAAGTGGCGAGCGTTCCGGGAAAGCGAAGACTCCC
GCTACGTATCGCTGGTGCTGCCGCATGTGTTGCAGCGTTTGCCTTATGGCCCGGATACGGTACCGGTTGA
AGGCGTCAACTTTGTCGAAGATGTTGACGGGATGGATGCGAGTAAATATCTGTGGGGCAACGCCGCGTGG
GCGCTGGCGGGGCGGATAACGGAAGCTTTTGCTCTGTATGGCTGGTGCGCGGCGATTCGCGGCGTGGAAG
GGGGCGGTCTGGTGGAAAATCTGCCAGCGCATACGTTCTCCACCCCTTCCGGTGACATCAGCCTGCGCTG
CCCGACGGAAGTGGCGATTACCGACCGGCGTGAGAAAGAACTTAACGATCTCGGCTTTATCGCCCTGTGC
CACAAGAAAAACAGCAATACCGCCGCCTTCTTTGGCGGACAGACCACCAATCAGGCGAAAATCTACAATA
CCCCGGAAGCCAACGCTAACGCGCGTATTTCCGCCATGTTGCCTTATATTCTTGCCGCCTCTCGCTTTGC
GCACTATCTGAAGGTGATCATGCGTGACAAAGTCGGCAGTTTTATGAGCCGTGATGAGGTCGAAAGCTAT
CTGAATAACTGGATTGCCGATTATGTGTTGCTGACCGACAGCGCGCCGCAGGAGATCAAAGCGCGTTATC
CGCTGCGCGAGGCTCGCGTTGATGTCAGCGAAGTGCCGGGCAAACCGGGCGTTTATCGTGCCGTCGTTTT
TCTGCGCCCGCACTTCCAGCTAGAAGAGTTGACCACCTCGATTCGTCTGGTCGCTGAACTGCCGCCGCCG
GCCGCCGCCTGA