SecReT6
Protein ID: 339999228
SecReT6 ID454
T6SS typei4a
Gene symbol-
Locus tagSBG_1241
StrainSalmonella bongori NCTC 12419
Repliconchromosome [GenBank: NC_015761] [Browse all T6SS(s) in this replicon]
Location [Strand]1360175..1360552 [+]
Producttype VI secretion protein gp25
NoteTssE
UniProt IDF8VIG7
KEGG IDsbg:SBG_1241
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.20E-13, Aligned region: 21..112
Protein Sequence: 125 a.a.     [Download]
>gi|339999228|ref|YP_004730111.1| type VI secretion protein gp25 [Salmonella bongori NCTC 12419]
MQASIPVALFDRLLDEEISPGESVRRELVRLFNSRAPADADELPPLLAWGVPEWHGLNVGDERVLDGYCR
QLRAAILRCEPRIKTLSISVKDAYQQTLMLHLDAELRDETEPLSLLLVWQDGRWQ
 
Nucleotide Sequence: 378 bp     [Download]
>gi|339998036|ref|NC_015761.1|:1360175-1360552 Salmonella bongori NCTC 12419, complete genome
ATGCAAGCCTCCATTCCGGTCGCGCTGTTTGACCGACTGCTGGATGAGGAGATAAGCCCCGGAGAGTCGG
TGCGCCGGGAGTTGGTTCGTCTTTTCAACTCCCGCGCGCCCGCAGATGCTGACGAATTACCACCGCTGCT
CGCCTGGGGCGTGCCGGAGTGGCACGGTCTCAATGTGGGCGATGAGCGGGTGCTCGACGGGTACTGCCGT
CAGCTACGCGCGGCGATTCTGCGTTGTGAACCGAGAATTAAGACGCTGAGTATCAGCGTGAAAGATGCGT
ATCAGCAGACGCTGATGCTGCATCTGGACGCTGAACTACGCGACGAGACTGAACCGCTGAGCCTGCTACT
GGTCTGGCAAGACGGTCGATGGCAATAA