SecReT6
Protein ID: 339999229
SecReT6 ID454
T6SS typei4a
Gene symbol-
Locus tagSBG_1242
StrainSalmonella bongori NCTC 12419
Repliconchromosome [GenBank: NC_015761] [Browse all T6SS(s) in this replicon]
Location [Strand]1360571..1362292 [+]
Producttype VI secretion protein VasA
NoteTssF
UniProt IDF8VIG8
KEGG IDsbg:SBG_1242
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.70E-130, Aligned region: 5..559
Protein Sequence: 573 a.a.     [Download]
>gi|339999229|ref|YP_004730112.1| type VI secretion protein VasA [Salmonella bongori NCTC 12419]
MDDRLLDDYLQELRWLRTVSGEFARQHPDVAARLRLSEFDCPDPHVERLLEGFALQSARLQRRLDDGFSE
LSASLLELLSPHLMRPFPASATACFTPDPLAGDLTHGYTLPAGTPLYALTKSGETVWWRTTLAQTLWPVV
IETLEWCDASVAQHYSGLQQARSALRIQLRCLPPYRFSTLAMKSLRICLNGSPQINATLFDLLYAHTIGP
LRPQPAGLRHAEQILPCESAVESGGLALSAWIHAPQALMYFDLPITPGGEEEILTLCIPFNQAPDSPLPL
QPHDIRLGCTPVVNLFPRTAEPLMVDHRRSEYRLVADHHDKNIQIYRVQALWLSHQQKACNVPPYYSAQG
HSDARWFWYARRNDKEDNALWLTLVDSRFDPRESAEEASITAKLWCSNGETAVQLPADSPLIFDFPGPIA
RVQLSGTPTPPSSPARQHDARWKLVSSLALNHLSLLEGEMALASLKEMLALYASSGASAAVWQQINGISD
MRCERVSEHYGQDAWRGWRNGIRVTLTLDPAAFTASSRLLFAAIVARFLARNATANCFVHTVLQDEEEAL
PLWSETGQSALIA
 
Nucleotide Sequence: 1722 bp     [Download]
>gi|339998036|ref|NC_015761.1|:1360571-1362292 Salmonella bongori NCTC 12419, complete genome
ATGGACGATCGATTACTGGATGACTATCTGCAAGAGCTCAGGTGGCTGCGTACGGTAAGCGGCGAGTTTG
CCCGCCAGCACCCGGACGTCGCTGCCCGGCTTCGCCTGAGCGAGTTCGACTGTCCCGATCCGCATGTGGA
ACGGCTGCTGGAAGGATTCGCCCTGCAAAGCGCCCGCCTGCAACGCCGGCTGGACGACGGTTTCAGCGAA
CTCAGCGCTTCGCTGCTGGAGCTGCTTTCTCCGCATCTGATGCGGCCTTTTCCCGCCAGCGCCACCGCCT
GCTTTACCCCCGACCCGCTGGCGGGCGATCTGACCCACGGTTATACCCTGCCTGCCGGCACGCCGCTGTA
CGCGCTGACGAAGAGCGGCGAAACGGTCTGGTGGCGCACCACCCTTGCGCAAACGCTATGGCCTGTCGTT
ATCGAGACGCTGGAGTGGTGCGACGCCTCAGTTGCGCAACACTACAGTGGCCTGCAACAGGCACGCAGCG
CACTACGCATCCAACTACGCTGTTTGCCGCCATACCGTTTTTCGACGCTGGCGATGAAATCGTTGCGCAT
CTGTCTTAACGGGTCGCCGCAGATTAACGCCACGCTGTTTGATTTGCTTTACGCACACACCATTGGCCCG
CTGCGCCCACAGCCCGCAGGCCTGCGCCATGCGGAGCAGATATTGCCCTGCGAATCCGCTGTGGAGTCGG
GGGGCCTGGCCTTAAGCGCCTGGATCCACGCGCCACAGGCATTAATGTATTTTGATTTGCCGATAACGCC
GGGCGGCGAGGAGGAGATCCTGACGCTCTGCATTCCGTTTAATCAGGCACCTGATTCGCCGCTGCCTCTT
CAACCGCACGATATTCGCCTTGGCTGCACGCCGGTGGTGAATCTCTTTCCCCGTACCGCAGAGCCGCTGA
TGGTGGATCACCGGCGTAGCGAATACCGGCTGGTGGCCGATCATCATGATAAAAATATCCAGATCTATCG
CGTGCAAGCGCTATGGCTGAGTCATCAGCAAAAGGCCTGCAACGTACCGCCGTACTACTCAGCGCAGGGG
CACAGCGACGCCCGCTGGTTCTGGTACGCGCGGCGCAACGACAAAGAGGATAACGCGCTGTGGCTGACGC
TGGTGGATAGCCGGTTCGACCCGAGGGAAAGCGCTGAAGAAGCCAGCATAACGGCAAAATTGTGGTGCAG
CAATGGCGAAACGGCTGTGCAACTTCCTGCCGACAGTCCGCTGATTTTCGACTTTCCCGGCCCGATAGCC
CGGGTACAGTTGTCAGGAACGCCCACACCGCCATCATCGCCAGCGCGTCAGCATGACGCCCGCTGGAAGC
TGGTCTCTTCGTTGGCGCTGAATCACCTGTCGCTGCTGGAGGGCGAAATGGCGCTGGCGTCGCTTAAAGA
GATGCTGGCCCTGTATGCCTCATCCGGCGCATCGGCAGCCGTCTGGCAACAAATCAATGGTATCAGCGAT
ATGCGCTGCGAGCGGGTGAGTGAGCATTACGGGCAGGACGCCTGGCGCGGATGGCGCAACGGTATCCGGG
TCACGCTGACGCTGGATCCCGCCGCGTTTACCGCCAGTAGCCGGCTGCTGTTTGCCGCCATTGTCGCCCG
TTTTCTGGCGCGTAACGCCACGGCGAACTGTTTTGTGCATACCGTATTACAGGATGAAGAGGAGGCGCTG
CCGTTATGGAGCGAGACCGGGCAGAGCGCATTGATAGCGTAA