SecReT6
Protein ID: 339999230
SecReT6 ID454
T6SS typei4a
Gene symbol-
Locus tagSBG_1243
StrainSalmonella bongori NCTC 12419
Repliconchromosome [GenBank: NC_015761] [Browse all T6SS(s) in this replicon]
Location [Strand]1362346..1363194 [+]
Producttype VI secretion protein SciN
NoteTssG
UniProt IDF8VIG9
KEGG IDsbg:SBG_1243
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.10E-41, Aligned region: 29..261
Protein Sequence: 282 a.a.     [Download]
>gi|339999230|ref|YP_004730113.1| type VI secretion protein SciN [Salmonella bongori NCTC 12419]
MLQLCGDSPQLCGELGLAFTPSETGVLRDGRLQVRSLGPGGADGVLPYAWLEVLQQAAQDKVRAPQNFLN
LFQRRLFAHHYRSLSLYRLATPYARREDAPGFAIMRALCGFDSKAQQGAATPNILAYSGLLANRRRSTAG
FVTLVAAVLNITVHTEEFIGRWQALPPAAISRTGCRLGRNSVAGRHAWNQHAALRLHLQARDAAQWRDFL
PGGRGFIQLGWLGRLWFGAGVELLLMMRGTLRLDNHLDRARPPCLGYSAQLTGRRLTSFCCQQSLKESVK
WI
 
Nucleotide Sequence: 849 bp     [Download]
>gi|339998036|ref|NC_015761.1|:1362346-1363194 Salmonella bongori NCTC 12419, complete genome
TTGCTGCAACTGTGCGGCGACTCGCCGCAGTTGTGTGGTGAGCTGGGGCTGGCGTTTACGCCTTCGGAAA
CCGGCGTGCTGCGCGACGGCAGGTTACAGGTTCGCAGTCTCGGCCCTGGCGGCGCAGACGGCGTTTTGCC
TTACGCCTGGCTGGAAGTGTTGCAACAGGCCGCGCAGGATAAGGTACGGGCGCCGCAGAATTTTTTAAAT
CTGTTTCAGCGCCGTTTATTTGCCCATCACTATCGCAGTCTGAGCCTGTACCGGCTGGCGACGCCCTACG
CCCGTCGTGAAGACGCGCCGGGGTTTGCCATTATGCGCGCGTTGTGTGGTTTTGATAGTAAGGCGCAACA
GGGCGCTGCGACGCCTAACATTCTGGCGTACAGCGGACTACTGGCCAATCGCAGACGGTCAACGGCTGGT
TTTGTGACGCTGGTTGCCGCGGTACTTAATATTACGGTGCATACCGAAGAGTTTATCGGCCGCTGGCAGG
CACTGCCGCCTGCCGCCATCAGCCGCACCGGTTGTCGTCTGGGGCGCAACAGCGTGGCAGGAAGGCACGC
CTGGAATCAGCATGCGGCGCTGCGCCTGCATTTGCAGGCCCGCGACGCGGCGCAGTGGCGGGATTTTCTC
CCCGGCGGCAGGGGATTTATCCAGCTTGGCTGGCTCGGCAGACTCTGGTTTGGCGCAGGGGTGGAACTGC
TGCTAATGATGAGAGGAACGCTGCGTCTGGATAATCATCTGGATCGCGCCAGGCCGCCGTGTCTGGGTTA
CAGCGCACAACTGACCGGACGCCGACTCACGTCGTTTTGTTGCCAACAATCTCTTAAGGAGAGCGTTAAA
TGGATTTAA