SecReT6
Protein ID: 339999231
SecReT6 ID454
T6SS typei4a
Gene symbol-
Locus tagSBG_1244
StrainSalmonella bongori NCTC 12419
Repliconchromosome [GenBank: NC_015761] [Browse all T6SS(s) in this replicon]
Location [Strand]1363185..1365698 [+]
Producttype VI secretion protein ClpV
NoteTssH
UniProt IDF8VIH0
KEGG IDsbg:SBG_1244
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.30E-38, Aligned region: 214..232
AAA_2 [PF07724], Evalue: 1.30E-38, Aligned region: 603..766
AAA [PF00004], Evalue: 9.10E-21, Aligned region: 215..347
AAA [PF00004], Evalue: 9.10E-21, Aligned region: 609..726
AAA_5 [PF07728], Evalue: 4.50E-16, Aligned region: 215..235
AAA_5 [PF07728], Evalue: 4.50E-16, Aligned region: 293..345
AAA_5 [PF07728], Evalue: 4.50E-16, Aligned region: 608..726
Clp_N [PF02861], Evalue: 9.30E-11, Aligned region: 21..70
Clp_N [PF02861], Evalue: 9.30E-11, Aligned region: 104..120
AAA_16 [PF13191], Evalue: 6.70E-10, Aligned region: 192..236
AAA_16 [PF13191], Evalue: 6.70E-10, Aligned region: 260..293
AAA_16 [PF13191], Evalue: 6.70E-10, Aligned region: 591..652
AAA_22 [PF13401], Evalue: 1.10E-09, Aligned region: 215..300
AAA_22 [PF13401], Evalue: 1.10E-09, Aligned region: 344..385
AAA_22 [PF13401], Evalue: 1.10E-09, Aligned region: 606..713
AAA_17 [PF13207], Evalue: 1.80E-08, Aligned region: 146..210
AAA_17 [PF13207], Evalue: 1.80E-08, Aligned region: 215..267
AAA_17 [PF13207], Evalue: 1.80E-08, Aligned region: 435..464
AAA_17 [PF13207], Evalue: 1.80E-08, Aligned region: 607..646
AAA_25 [PF13481], Evalue: 1.10E-07, Aligned region: 215..371
AAA_25 [PF13481], Evalue: 1.10E-07, Aligned region: 416..474
AAA_25 [PF13481], Evalue: 1.10E-07, Aligned region: 605..633
Zeta_toxin [PF06414], Evalue: 3.10E-07, Aligned region: 215..236
Zeta_toxin [PF06414], Evalue: 3.10E-07, Aligned region: 600..648
AAA_14 [PF13173], Evalue: 7.50E-07, Aligned region: 215..314
AAA_14 [PF13173], Evalue: 7.50E-07, Aligned region: 607..699
AAA_19 [PF13245], Evalue: 1.40E-06, Aligned region: 212..239
AAA_19 [PF13245], Evalue: 1.40E-06, Aligned region: 606..630
IstB_IS21 [PF01695], Evalue: 2.30E-06, Aligned region: 209..234
IstB_IS21 [PF01695], Evalue: 2.30E-06, Aligned region: 608..628
Sigma54_activat [PF00158], Evalue: 9.20E-06, Aligned region: 196..231
Sigma54_activat [PF00158], Evalue: 9.20E-06, Aligned region: 608..707
AAA_18 [PF13238], Evalue: 1.10E-05, Aligned region: 215..235
AAA_18 [PF13238], Evalue: 1.10E-05, Aligned region: 343..390
AAA_18 [PF13238], Evalue: 1.10E-05, Aligned region: 609..639
T2SE [PF00437], Evalue: 3.30E-05, Aligned region: 205..231
T2SE [PF00437], Evalue: 3.30E-05, Aligned region: 579..686
ResIII [PF04851], Evalue: 4.10E-05, Aligned region: 205..239
ResIII [PF04851], Evalue: 4.10E-05, Aligned region: 285..297
ResIII [PF04851], Evalue: 4.10E-05, Aligned region: 580..630
NACHT [PF05729], Evalue: 7.70E-05, Aligned region: 215..243
NACHT [PF05729], Evalue: 7.70E-05, Aligned region: 608..634
RNA_helicase [PF00910], Evalue: 0.00086, Aligned region: 216..236
RNA_helicase [PF00910], Evalue: 0.00086, Aligned region: 609..630
AAA_23 [PF13476], Evalue: 0.0013, Aligned region: 215..232
AAA_23 [PF13476], Evalue: 0.0013, Aligned region: 423..478
AAA_23 [PF13476], Evalue: 0.0013, Aligned region: 606..634
RuvB_N [PF05496], Evalue: 0.0021, Aligned region: 214..232
RuvB_N [PF05496], Evalue: 0.0021, Aligned region: 286..295
RuvB_N [PF05496], Evalue: 0.0021, Aligned region: 566..629
RuvB_N [PF05496], Evalue: 0.0021, Aligned region: 677..701
SRP54 [PF00448], Evalue: 0.0025, Aligned region: 215..237
SRP54 [PF00448], Evalue: 0.0025, Aligned region: 355..384
SRP54 [PF00448], Evalue: 0.0025, Aligned region: 493..517
SRP54 [PF00448], Evalue: 0.0025, Aligned region: 607..644
SRP54 [PF00448], Evalue: 0.0025, Aligned region: 773..826
Torsin [PF06309], Evalue: 0.003, Aligned region: 565..631
Arch_ATPase [PF01637], Evalue: 0.0046, Aligned region: 193..227
Arch_ATPase [PF01637], Evalue: 0.0046, Aligned region: 267..300
Arch_ATPase [PF01637], Evalue: 0.0046, Aligned region: 607..650
AAA_33 [PF13671], Evalue: 0.007, Aligned region: 215..232
AAA_33 [PF13671], Evalue: 0.007, Aligned region: 607..629
AAA_29 [PF13555], Evalue: 0.0073, Aligned region: 207..227
AAA_29 [PF13555], Evalue: 0.0073, Aligned region: 604..633
AAA_28 [PF13521], Evalue: 0.0095, Aligned region: 215..236
AAA_28 [PF13521], Evalue: 0.0095, Aligned region: 416..416
AAA_28 [PF13521], Evalue: 0.0095, Aligned region: 608..628
Protein Sequence: 837 a.a.     [Download]
>gi|339999231|ref|YP_004730114.1| type VI secretion protein ClpV [Salmonella bongori NCTC 12419]
MDLKILVQKLNPVCLRALEQAAERSRAQGHWFVEPEHLLLALLDDEHCDFVCCLNGAAIPVDALRDEILR
AQGQFKTGCTRMPVFSLQLVELLEGAILQATFQNHTEVRSALVLLALLTRDRLRVQLAQGMPLLLKIPTE
MLENQWREWCRGAAEDAAKPVKGETPRHSGGVLEQYTHDLTHDAREGRIDPIIGRDAEIRQCIDILLRRR
QNNPILVGAPGVGKTAVAEGLALRIAEGKVPPPLREVVLLSLDLGLLQAGAGVKGEFEQRLRGVIEAVKT
SPQPIILFIDEAHTLIGAGGAEGGSDAANLLKPALARGELRTIAATTWQEYKKYFEKDPALDRRFQRIQI
EEPDENGAVVMLRAVADKLEAHHGVQILDTAIREAVRLSQRYISGRQLPDKAISVLDTACARVALAQHDV
PPQLEEIRQHLAAIEEESARLNRELLVGVDHHDRLCDLAAQAEKLHQQAREVEERWQDERQRVGELQAAR
QRMLDLSVRLEEDDELEEELVECAALIGKLETAAAQLREEVPLVPDCVDPATVASVISGWTGIPIGQMQT
DEAHALRTLVDRMSERVMGQQMALETIAQRLRAYRSGLTDPQKPVGVFLLVGPTGVGKTETAYALADALY
GGERNLITINLSEYQEAHTVSQLKGAPPGYVGYGSGGALTEAVRRRPYSVVLLDEIEKAHPDVLEAFYNV
FDKGVMEDGTGLIVDFKNTVMLATSNVGAELILETPAAELNSEQFNEALREELLRHFRPAFLARMTTVAY
RALDEEILKGIVLAKLEKLAQRYFVATGEKLNIINNIALDLSFFSRAGDVRNIENTLINKILEKNRI
 
Nucleotide Sequence: 2514 bp     [Download]
>gi|339998036|ref|NC_015761.1|:1363185-1365698 Salmonella bongori NCTC 12419, complete genome
ATGGATTTAAAAATACTGGTACAAAAACTTAATCCGGTTTGTTTACGCGCCCTGGAGCAGGCAGCAGAAC
GCAGCCGGGCGCAGGGCCACTGGTTCGTGGAGCCGGAACATTTGTTACTGGCGCTACTGGATGATGAGCA
TTGTGATTTCGTTTGCTGTCTTAACGGCGCAGCGATCCCGGTTGACGCTCTGCGCGATGAGATCCTGCGC
GCGCAGGGACAGTTCAAAACAGGCTGTACGCGGATGCCGGTATTTTCTTTGCAACTGGTTGAGTTGCTGG
AGGGTGCCATTTTACAGGCGACCTTTCAGAATCATACCGAGGTACGTTCCGCGCTGGTATTGTTGGCATT
ACTGACTCGTGACCGCCTGCGCGTCCAGCTGGCGCAGGGAATGCCGCTGCTGTTGAAAATTCCCACTGAG
ATGCTGGAGAACCAATGGCGAGAGTGGTGCCGGGGAGCGGCGGAAGATGCGGCAAAACCGGTAAAAGGCG
AAACCCCACGGCATAGTGGCGGCGTGCTTGAACAATACACCCACGATCTGACTCATGATGCGCGGGAAGG
GCGGATCGACCCGATCATCGGGCGCGATGCGGAGATCCGCCAGTGTATCGACATCCTGCTGCGTCGCAGG
CAGAACAACCCGATTCTGGTCGGTGCGCCAGGCGTGGGGAAAACCGCCGTCGCTGAAGGGCTGGCGCTGC
GCATCGCCGAAGGCAAGGTACCGCCTCCCCTGCGCGAGGTGGTGTTACTTTCGCTCGATCTTGGCCTATT
GCAGGCAGGCGCTGGTGTGAAAGGCGAGTTTGAACAGCGTTTGCGCGGCGTGATCGAGGCGGTAAAAACA
TCCCCGCAGCCGATTATTCTGTTTATCGACGAGGCCCATACGCTGATTGGCGCGGGCGGCGCCGAAGGCG
GCAGCGACGCCGCCAACCTGCTGAAACCGGCGCTGGCGCGCGGCGAACTGCGTACCATCGCCGCCACTAC
CTGGCAGGAGTATAAAAAGTATTTCGAGAAGGATCCGGCGCTGGACCGCCGTTTTCAGCGTATCCAGATT
GAAGAGCCGGACGAGAACGGTGCGGTGGTGATGCTGCGGGCGGTGGCCGATAAACTGGAGGCGCATCACG
GCGTGCAAATTCTGGATACCGCCATCCGCGAGGCGGTGCGCCTCTCGCAGCGCTATATCTCTGGTCGCCA
GTTGCCGGACAAAGCAATCAGCGTGCTCGATACCGCCTGCGCGCGGGTGGCGCTGGCGCAGCATGACGTG
CCGCCCCAGCTGGAGGAGATCCGCCAGCATCTGGCGGCCATCGAGGAAGAGAGCGCGCGCCTGAACCGCG
AACTGCTGGTGGGCGTCGATCATCACGACCGGCTGTGCGACCTGGCGGCGCAGGCGGAAAAACTCCACCA
GCAGGCGCGGGAGGTGGAGGAGCGCTGGCAGGATGAGCGCCAGCGGGTCGGCGAGCTGCAGGCCGCCCGT
CAGCGGATGCTGGATCTCAGCGTGCGGCTGGAAGAAGACGATGAACTGGAAGAGGAGCTGGTGGAGTGCG
CGGCGCTGATTGGCAAACTGGAAACCGCCGCCGCCCAGCTACGTGAAGAAGTGCCGCTGGTGCCGGACTG
CGTCGATCCCGCCACCGTGGCTTCGGTGATCAGCGGCTGGACCGGGATCCCGATAGGCCAGATGCAGACC
GATGAAGCCCACGCTCTGCGCACCCTGGTAGACCGGATGAGCGAGCGTGTGATGGGGCAGCAGATGGCGC
TGGAGACTATCGCCCAGCGCCTGCGCGCCTACCGCAGCGGCCTGACCGATCCGCAAAAGCCGGTCGGCGT
GTTCCTGCTGGTGGGGCCAACCGGTGTGGGCAAAACCGAAACTGCCTATGCGCTGGCCGACGCCCTCTAC
GGCGGCGAACGCAATCTGATCACCATCAACCTGTCTGAATATCAGGAGGCGCACACCGTCAGCCAGCTTA
AAGGCGCGCCGCCGGGCTACGTTGGCTATGGTAGCGGCGGGGCGTTAACCGAAGCGGTGCGCCGTCGGCC
TTATTCGGTGGTGCTGCTCGACGAAATCGAAAAGGCACACCCGGACGTACTGGAGGCGTTTTATAACGTT
TTCGACAAAGGGGTAATGGAAGACGGCACCGGGCTGATTGTCGATTTCAAAAATACGGTGATGCTGGCGA
CCAGCAACGTCGGCGCGGAATTAATTCTGGAAACGCCGGCGGCTGAATTAAATAGCGAGCAGTTTAACGA
GGCGCTGCGTGAGGAACTGCTGCGTCATTTCCGCCCGGCGTTTTTAGCGCGGATGACCACGGTGGCCTAT
CGCGCACTGGATGAGGAGATATTAAAAGGAATTGTGCTGGCGAAACTGGAGAAATTAGCACAGCGGTATT
TTGTGGCGACGGGGGAGAAGTTGAATATTATAAATAATATAGCTTTAGATTTATCATTTTTTTCCAGGGC
AGGGGATGTGAGAAATATAGAAAATACGCTTATAAATAAAATCCTTGAAAAAAATAGAATTTAA