SecReT6
Protein ID: 340616407
SecReT6 ID920
T6SS typeiii
Gene symbol-
Locus tagzobellia_395
StrainZobellia galactanivorans DsiJT
Repliconchromosome [GenBank: NC_015844] [Browse all T6SS(s) in this replicon]
Location [Strand]532117..532506 [-]
Producthypothetical protein
NoteHcp
UniProt IDG0L9B0
KEGG IDzga:zobellia_395
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 129 a.a.     [Download]
>gi|340616407|ref|YP_004734860.1| hypothetical protein zobellia_395 [Zobellia galactanivorans]
MSFLAKLIIDGQDYNVLHCTYNFEQPMDSTGKPAGKPLGGQIMITLESQGKFDLFHWMSSSDQTKDGTII
FYKRDAMSQLQRVEFTKAYCVSLEEEFDAIDDVPMQKRIVISAQSIKIGDMVFQNRWGE
 
Nucleotide Sequence: 390 bp     [Download]
>gi|340616011|ref|NC_015844.1|:c532506-532117 Zobellia galactanivorans chromosome, complete genome
ATGTCTTTTTTAGCAAAACTCATTATTGATGGGCAGGACTACAACGTCTTGCACTGTACCTATAATTTTG
AACAACCTATGGATTCTACGGGCAAACCTGCCGGGAAACCATTGGGTGGTCAAATCATGATTACCTTGGA
ATCCCAGGGAAAATTCGATCTGTTCCATTGGATGTCTTCTTCAGATCAAACGAAGGACGGAACGATTATC
TTCTATAAGCGCGACGCCATGTCGCAATTGCAACGGGTGGAGTTTACCAAGGCCTATTGTGTTAGCCTTG
AGGAAGAATTTGACGCCATCGATGATGTGCCTATGCAAAAGCGCATCGTTATTTCGGCACAGAGCATTAA
AATCGGTGATATGGTCTTTCAGAATCGTTGGGGGGAGTAG

Protein ID: 340616410
SecReT6 ID920
T6SS typeiii
Gene symbol-
Locus tagzobellia_398
StrainZobellia galactanivorans DsiJT
Repliconchromosome [GenBank: NC_015844] [Browse all T6SS(s) in this replicon]
Location [Strand]534492..534878 [-]
Producthypothetical protein
NoteHcp
UniProt IDG0L9B3
KEGG IDzga:zobellia_398
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 128 a.a.     [Download]
>gi|340616410|ref|YP_004734863.1| hypothetical protein zobellia_398 [Zobellia galactanivorans]
MAFKAKLKVAGKEFTVLHCSYDLNQEVDPTGRPSSVTRGGRINMTVESNGETGFFEWMTNNFERKDGSIV
FIKRDTDATLKEVKFKEGYLIKYKENFDATGQNPLTESFTISAKELASGGGEHVNEWV
 
Nucleotide Sequence: 387 bp     [Download]
>gi|340616011|ref|NC_015844.1|:c534878-534492 Zobellia galactanivorans chromosome, complete genome
ATGGCTTTTAAAGCAAAATTGAAAGTTGCGGGAAAAGAGTTTACCGTTTTACACTGTTCTTATGATTTAA
ACCAAGAAGTTGATCCAACAGGAAGACCTTCTTCTGTTACCCGTGGTGGCAGAATCAACATGACTGTTGA
ATCAAATGGGGAAACCGGTTTTTTTGAATGGATGACCAACAACTTTGAAAGAAAAGACGGAAGTATTGTC
TTTATTAAGCGTGATACTGACGCAACTTTAAAAGAAGTTAAATTCAAGGAAGGTTATTTGATCAAGTACA
AAGAAAACTTTGATGCTACCGGTCAGAACCCATTAACTGAATCATTTACTATTTCTGCCAAGGAATTGGC
CAGTGGTGGTGGTGAACATGTCAATGAATGGGTATAA