SecReT6
Protein ID: 340616408
SecReT6 ID920
T6SS typeiii
Gene symbol-
Locus tagzobellia_396
StrainZobellia galactanivorans DsiJT
Repliconchromosome [GenBank: NC_015844] [Browse all T6SS(s) in this replicon]
Location [Strand]532550..533899 [-]
Producthypothetical protein
NoteTssC
UniProt IDG0L9B1
KEGG IDzga:zobellia_396
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.40E-14, Aligned region: 113..257
DUF877 [PF05943], Evalue: 5.40E-14, Aligned region: 281..395
Phage_sheath_1 [PF04984], Evalue: 5.40E-06, Aligned region: 177..430
Protein Sequence: 449 a.a.     [Download]
>gi|340616408|ref|YP_004734861.1| hypothetical protein zobellia_396 [Zobellia galactanivorans]
MSDKLKQSQLSDKPFIEQIKEKSDNLAKYGGFDLLESAIDDVQNLNPDRKARRKMFLTENNKKQERESLL
KILSLWSDTLKSGDDIIGLVQAADDKAQESQKTYTKNIKTALEETRELETSYRSVALFYKNTDLPSLKNV
TVVNAELDQLTDLDNTRFFDYIREELVSKYDRLDLRENYSLMVLPGYLGSKSVVDKWAKLAHENKVTLVT
DFAHLDEPDDVMEMFESANLASGDAYLSNTIMTCNWLVGRGKYDEVGEEEDVHVPPSGALAGKIYKTLMS
QVTAGKKHGGLSEVDGVRFDLRKSEIANLENLGLVPMVNEYGKVMAFSAKTLFNGDNLGLQTYSVVRVFD
YVTKVLMDFLNRRAFENFDARTRKEIQNQIVRFLDEITGPGKLIENFEIRRFEQDINQKDRIYLDVRLKP
YFPAKNFLIKMDGQKGDEGAEWDTDYQQS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|340616011|ref|NC_015844.1|:c533899-532550 Zobellia galactanivorans chromosome, complete genome
ATGTCCGATAAACTAAAACAGTCACAACTAAGTGACAAACCTTTCATTGAGCAAATCAAGGAAAAATCAG
ATAACCTTGCCAAATACGGTGGGTTTGATTTATTAGAATCTGCTATTGATGATGTTCAGAACCTAAACCC
CGATCGTAAGGCACGTAGAAAAATGTTCCTTACCGAAAACAATAAAAAACAAGAGCGGGAGTCGCTTTTG
AAAATTTTATCGCTTTGGTCGGATACCTTGAAATCAGGGGATGATATCATAGGCTTGGTACAAGCTGCCG
ATGATAAGGCTCAAGAATCACAAAAAACATACACCAAAAATATTAAAACGGCACTGGAAGAGACTCGAGA
ATTGGAGACCTCTTACCGTTCTGTTGCCCTATTTTATAAAAACACCGATTTACCTTCATTGAAGAACGTA
ACCGTGGTCAATGCCGAATTGGACCAATTGACCGATTTGGACAATACACGTTTCTTTGATTACATACGTG
AAGAATTGGTGTCTAAATATGACCGTTTAGACCTAAGGGAGAACTATTCGCTTATGGTGCTTCCAGGTTA
TCTAGGTTCAAAATCGGTTGTGGATAAATGGGCAAAATTGGCCCATGAAAACAAAGTGACCTTGGTTACC
GATTTTGCGCATTTAGATGAACCGGACGATGTGATGGAAATGTTCGAAAGTGCCAACTTGGCCAGTGGCG
ATGCTTATTTGTCCAATACGATCATGACCTGTAACTGGTTGGTCGGTAGAGGTAAGTATGATGAGGTAGG
TGAAGAAGAAGATGTACATGTACCGCCCTCTGGAGCCTTGGCGGGAAAAATATACAAGACCTTAATGTCA
CAGGTTACCGCTGGTAAAAAGCACGGTGGACTAAGTGAAGTTGATGGAGTGCGTTTTGACCTTCGGAAAA
GTGAGATTGCCAATTTAGAAAACTTAGGATTGGTACCTATGGTAAATGAATATGGCAAAGTAATGGCCTT
TTCGGCCAAAACCTTGTTCAATGGTGACAACCTAGGGCTACAGACCTATTCCGTAGTACGTGTTTTCGAT
TATGTGACCAAAGTGTTGATGGACTTCCTTAACAGAAGGGCCTTTGAAAACTTCGATGCACGAACCAGAA
AGGAAATACAAAACCAAATCGTTCGCTTTTTGGATGAAATTACTGGTCCCGGTAAATTGATCGAGAATTT
TGAGATCCGTCGTTTCGAACAGGATATTAATCAAAAGGACCGTATTTATTTAGACGTGCGTTTAAAACCT
TATTTCCCGGCCAAAAACTTCTTGATTAAGATGGACGGTCAAAAAGGTGATGAGGGTGCCGAATGGGATA
CCGATTACCAACAAAGTTAA