SecReT6
Protein ID: 340616409
SecReT6 ID920
T6SS typeiii
Gene symbol-
Locus tagzobellia_397
StrainZobellia galactanivorans DsiJT
Repliconchromosome [GenBank: NC_015844] [Browse all T6SS(s) in this replicon]
Location [Strand]533918..534370 [-]
Producthypothetical protein
NoteTssB
UniProt IDG0L9B2
KEGG IDzga:zobellia_397
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 150 a.a.     [Download]
>gi|340616409|ref|YP_004734862.1| hypothetical protein zobellia_397 [Zobellia galactanivorans]
MAIGNLGIGGNEVKGDANEALTEIPQNRTLIVGKLTPNAPVKPEAIEGLRTIEDAFEHFEPKLNIPFEDK
DGGVFNEELSFTNLGDFGKKGITNNSVFLKELEIESDQYKKIIKQLKTNKILKAALEDPEAKQSLVETID
ALIEEIKNAK
 
Nucleotide Sequence: 453 bp     [Download]
>gi|340616011|ref|NC_015844.1|:c534370-533918 Zobellia galactanivorans chromosome, complete genome
ATGGCTATAGGTAATCTAGGTATAGGTGGTAATGAGGTAAAAGGCGACGCAAACGAGGCCTTGACCGAAA
TACCACAGAATAGAACTTTAATTGTAGGTAAGTTGACCCCAAATGCTCCGGTAAAGCCCGAGGCTATTGA
AGGACTTAGGACAATTGAAGATGCTTTTGAGCATTTTGAACCTAAACTGAATATCCCGTTCGAGGATAAA
GACGGTGGCGTTTTTAATGAGGAACTTTCGTTCACCAACTTAGGTGATTTTGGTAAAAAGGGAATTACAA
ATAACAGTGTGTTTTTAAAAGAGTTGGAAATTGAAAGTGATCAATACAAAAAGATCATCAAGCAATTGAA
GACCAACAAAATTTTAAAAGCGGCATTGGAAGACCCTGAAGCCAAACAATCATTGGTTGAGACTATTGAT
GCGCTTATCGAGGAAATCAAAAATGCCAAATAA