SecReT6
Protein ID: 340616411
SecReT6 ID920
T6SS typeiii
Gene symbol-
Locus tagzobellia_399
StrainZobellia galactanivorans DsiJT
Repliconchromosome [GenBank: NC_015844] [Browse all T6SS(s) in this replicon]
Location [Strand]535250..536284 [-]
ProductPKD repeat-containing protein
NoteTssP
UniProt IDG0L9B4
KEGG IDzga:zobellia_399
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 4.00E-12, Aligned region: 63..100
PKD [PF00801], Evalue: 4.00E-12, Aligned region: 132..186
Toprim_N [PF08275], Evalue: 0.00097, Aligned region: 222..298
Protein Sequence: 344 a.a.     [Download]
>gi|340616411|ref|YP_004734864.1| PKD repeat-containing protein [Zobellia galactanivorans]
MIHKRIKTHFDKNVFISFLVLVIFGLGLLSFRLNSKVDCSNVDFEMIAESYTTADLIEFKSIDPSGVEWE
WDFGKDIPKKYRSNVVHQFTKEGTYTVSLKMNGQCGVTKQIEISKPKDLIVPELIPNIILPEYVRVGQEV
EFSNDSEFAESWQWSFGESMTIDGNNRKEKYVYKSPGEKTVLLVVNGDRRHEAKQRITVLPEKKSRKRRA
SITRVDPIETVLQDQIRDKPKAEDKAAADAEQRKKEEVANRIEVSNDDMQQMFISYSGRNLDDISIRKYF
CYSNIPVFNKTGNRFTVSQFFKEIRDVNKLEIKSIKMIKDKKTGCVKSMTIDMRTKKGLFWKTF
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|340616011|ref|NC_015844.1|:c536284-535250 Zobellia galactanivorans chromosome, complete genome
ATGATTCATAAAAGGATTAAAACCCACTTTGACAAAAACGTATTTATCTCTTTTTTAGTATTGGTGATTT
TTGGTCTTGGGCTTTTATCATTTAGATTGAACAGTAAGGTAGACTGTAGCAATGTTGATTTTGAAATGAT
TGCCGAATCTTATACCACTGCCGATTTGATCGAATTTAAAAGTATAGACCCATCGGGCGTGGAGTGGGAG
TGGGATTTTGGAAAAGATATTCCTAAAAAATACAGGTCTAATGTGGTGCATCAGTTCACCAAGGAAGGTA
CTTATACGGTATCCTTAAAAATGAACGGTCAATGCGGGGTGACAAAACAGATTGAAATTTCAAAACCGAA
GGACCTGATCGTTCCTGAACTGATTCCTAATATAATTCTTCCCGAATACGTAAGGGTCGGCCAAGAAGTT
GAATTCTCGAACGATTCGGAATTTGCCGAGTCGTGGCAATGGAGCTTTGGGGAGTCGATGACCATTGATG
GCAACAATCGCAAAGAGAAGTATGTCTATAAGAGTCCCGGGGAAAAAACCGTTCTATTGGTCGTGAATGG
CGATAGGCGTCATGAAGCCAAGCAGCGGATTACCGTTTTGCCGGAAAAGAAAAGTAGAAAAAGAAGGGCA
AGCATAACCCGTGTAGATCCTATTGAAACGGTTCTTCAAGATCAGATAAGGGATAAACCCAAGGCCGAAG
ATAAGGCTGCTGCGGATGCGGAACAAAGGAAAAAGGAAGAAGTTGCCAATAGAATAGAAGTGTCAAACGA
TGATATGCAGCAAATGTTTATTTCCTATTCCGGTAGGAACCTTGATGATATTTCCATTCGAAAATACTTC
TGTTATAGTAATATACCTGTTTTCAATAAAACAGGCAACCGGTTTACGGTGAGCCAGTTTTTTAAGGAAA
TAAGGGATGTGAACAAACTAGAGATCAAGAGTATAAAAATGATCAAGGATAAGAAAACAGGTTGCGTAAA
AAGTATGACCATCGATATGCGAACCAAAAAAGGCTTGTTCTGGAAGACCTTTTAA