SecReT6
Protein ID: 340616413
SecReT6 ID920
T6SS typeiii
Gene symbol-
Locus tagzobellia_401
StrainZobellia galactanivorans DsiJT
Repliconchromosome [GenBank: NC_015844] [Browse all T6SS(s) in this replicon]
Location [Strand]536979..537884 [+]
Producthypothetical protein
NoteTssG
UniProt IDG0L9B6
KEGG IDzga:zobellia_401
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 301 a.a.     [Download]
>gi|340616413|ref|YP_004734866.1| hypothetical protein zobellia_401 [Zobellia galactanivorans]
MKDFPENDIRQEVFNLDFDLKAETLLSYIEEDTQVDLSLSDFFKRRFSKDITRIEKDRYNDDTLNVHLSR
RSFYNVLPERFFHSTYISTPFVNTMVADYHGRKIEQENALKFFKPLETEFFLHRVDIESAENEILTALGS
PKLVDFLMDLWKIDERIPKRMAAKILKTMPFMYKIAGNIPLLKKILENIIEEEILIEKDFATAGLPVTNE
PWQLGVNMATSGKQKTFLPKYIFTMNNISRPENIEDYLPDGKITAVVNFFLEHTLPHESDFEINFRLPKR
KTRFIMTEDAYSGRLGISATI
 
Nucleotide Sequence: 906 bp     [Download]
>gi|340616011|ref|NC_015844.1|:536979-537884 Zobellia galactanivorans chromosome, complete genome
ATGAAAGATTTCCCCGAAAACGACATACGCCAAGAGGTATTCAATTTGGATTTTGACCTAAAGGCGGAAA
CCCTACTTTCCTATATTGAGGAAGATACCCAGGTCGATCTTTCGCTCAGCGACTTTTTTAAGCGTCGCTT
TAGTAAAGATATCACCCGTATTGAAAAAGACCGTTATAATGATGATACCCTGAACGTTCACCTAAGTCGA
CGTAGCTTTTACAATGTTTTGCCCGAACGTTTCTTTCATTCCACCTATATTAGTACTCCTTTTGTAAATA
CCATGGTGGCGGATTACCATGGCAGAAAAATTGAACAGGAGAATGCCTTGAAGTTTTTCAAACCCTTGGA
AACCGAGTTCTTTCTTCATCGTGTCGATATCGAATCTGCCGAAAACGAAATCCTAACAGCCTTGGGAAGT
CCCAAATTGGTTGACTTTTTAATGGATTTATGGAAAATAGACGAAAGGATTCCGAAACGTATGGCGGCAA
AAATTTTAAAAACTATGCCGTTCATGTATAAAATAGCCGGAAATATTCCGTTGTTAAAAAAGATACTTGA
AAATATCATAGAAGAAGAGATCTTGATCGAGAAAGATTTTGCTACCGCAGGCCTACCTGTTACGAACGAA
CCATGGCAACTTGGCGTGAATATGGCGACCTCGGGAAAACAAAAGACCTTTCTGCCTAAATATATTTTTA
CAATGAACAACATTAGCCGCCCTGAAAACATAGAGGATTACCTGCCTGACGGGAAAATAACGGCTGTCGT
CAATTTCTTTTTGGAACATACCTTGCCCCATGAAAGTGATTTTGAAATCAACTTCAGGCTACCTAAGCGT
AAAACAAGATTTATAATGACCGAGGACGCCTATTCAGGTAGACTTGGAATATCGGCAACAATTTAA