SecReT6
Protein ID: 340616414
SecReT6 ID920
T6SS typeiii
Gene symbol-
Locus tagzobellia_402
StrainZobellia galactanivorans DsiJT
Repliconchromosome [GenBank: NC_015844] [Browse all T6SS(s) in this replicon]
Location [Strand]537891..538757 [+]
Producthypothetical protein
NoteTssN
UniProt IDG0L9B7
KEGG IDzga:zobellia_402
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 288 a.a.     [Download]
>gi|340616414|ref|YP_004734867.1| hypothetical protein zobellia_402 [Zobellia galactanivorans]
MIKSYFRKFISFESIMPFAIVLVVVALVLHFLGSKTPGFKTRRKKYYVYLAANIVVMALFVAIIYNLKQS
SLLLRYFSMLGFATIMGVANVFFHRSIFEKFDTHQKLKELVFAIISGLVLMVPIIMIAAHFNDLQYLPYY
FLVIAAYVFPTSFFILYEYSISIPAKLFTKWYYPMGNKYDAPKHYELNNMIVLNFMFYKNANSPNMTSFK
AKAPKDMDFGRLFYFFINDYNNKKTTTKIEVTSDTGDPHGWYFYSKPKWYGTSKHIDPERTVEENNLKDS
DTVVCQRI
 
Nucleotide Sequence: 867 bp     [Download]
>gi|340616011|ref|NC_015844.1|:537891-538757 Zobellia galactanivorans chromosome, complete genome
ATGATCAAAAGTTACTTTAGAAAATTCATAAGTTTTGAATCTATAATGCCCTTTGCCATTGTTTTGGTGG
TAGTGGCCCTGGTTCTTCATTTCTTGGGTTCAAAAACCCCCGGGTTTAAAACCAGGCGCAAAAAATACTA
TGTCTACCTAGCGGCCAATATAGTGGTTATGGCACTCTTCGTGGCCATCATATATAACCTGAAGCAGTCA
TCTTTACTATTACGGTATTTTTCAATGCTCGGTTTTGCCACCATCATGGGGGTGGCCAATGTCTTCTTTC
ACAGAAGCATCTTTGAAAAATTCGACACCCACCAAAAGCTTAAGGAATTGGTGTTCGCCATAATTTCCGG
ATTGGTATTAATGGTTCCTATTATAATGATAGCCGCACATTTTAACGACCTGCAGTACTTGCCTTACTAC
TTTTTGGTCATTGCTGCCTATGTATTCCCTACCAGCTTTTTCATCCTATATGAATATTCCATTTCCATTC
CCGCAAAACTATTTACCAAATGGTATTACCCCATGGGCAATAAGTACGATGCGCCAAAGCATTACGAGCT
CAACAACATGATCGTTCTGAATTTTATGTTCTACAAGAATGCCAATTCACCGAATATGACCAGTTTCAAG
GCGAAGGCGCCAAAAGATATGGACTTCGGAAGATTGTTCTATTTCTTTATCAATGATTACAACAACAAGA
AAACAACGACCAAAATTGAAGTTACCTCCGATACAGGAGACCCCCATGGATGGTACTTTTACAGTAAACC
TAAATGGTATGGGACATCAAAACATATAGACCCGGAACGCACCGTGGAAGAAAACAACCTAAAAGATAGC
GATACAGTCGTTTGCCAACGTATTTAA