SecReT6
Protein ID: 340616415
SecReT6 ID920
T6SS typeiii
Gene symbol-
Locus tagzobellia_403
StrainZobellia galactanivorans DsiJT
Repliconchromosome [GenBank: NC_015844] [Browse all T6SS(s) in this replicon]
Location [Strand]538768..539910 [+]
Producthypothetical protein
NoteTssK
UniProt IDG0L9B8
KEGG IDzga:zobellia_403
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.30E-08, Aligned region: 48..95
DUF876 [PF05936], Evalue: 3.30E-08, Aligned region: 165..273
DUF876 [PF05936], Evalue: 3.30E-08, Aligned region: 317..346
Protein Sequence: 380 a.a.     [Download]
>gi|340616415|ref|YP_004734868.1| hypothetical protein zobellia_403 [Zobellia galactanivorans]
MIEDIKNFKINWVDGMKISKEHFQSLQNFAENSIKDAFVVRMGKYGHGFLASHLFGNNEYAINLDIHKSL
KVSFNRLRAVTPNGNRIEITENTPDVKEEIVVAELADKTLEEGFVLINIDTANPIPFGNQDPAEVPPRLP
YLTHGYFFSFVSASDLEKSGLTGNQLPIAKIEKEGKGLSVATDYIPPCTTLGAHESLIHFYNESESFLKM
TERNAILIVQKIMSKQSDNPIADAMKLVVDKIYVYLAQQITKVKWEEHDMHPRELLQILVSFARIFKGSV
DISSPENKEQLFNYFGEWTDLKGGDYEKLFTDVINLQYNHNDVNENLQVINVFMQTIDRLLTVLTQVDYI
GKRRDMGIFVNENIVEEKPRKSRGTSFLAE
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|340616011|ref|NC_015844.1|:538768-539910 Zobellia galactanivorans chromosome, complete genome
ATGATAGAAGATATCAAAAATTTCAAGATCAATTGGGTAGATGGAATGAAAATCTCAAAAGAGCATTTTC
AAAGCCTTCAAAACTTTGCTGAAAACAGTATAAAAGATGCCTTTGTTGTACGCATGGGGAAATACGGACA
CGGATTTCTTGCCTCGCATCTCTTTGGCAACAACGAATACGCCATAAACCTTGATATTCACAAGAGCTTA
AAGGTTTCATTCAATAGATTAAGGGCCGTCACCCCCAATGGCAACCGTATCGAGATCACCGAAAACACTC
CCGATGTCAAGGAAGAGATCGTAGTGGCCGAGCTGGCCGACAAAACACTGGAGGAAGGTTTCGTCTTGAT
CAATATCGACACGGCAAACCCTATTCCTTTTGGCAATCAAGACCCCGCTGAAGTCCCCCCAAGGCTTCCC
TACCTTACACACGGGTATTTTTTCTCCTTTGTTAGTGCGTCCGACCTAGAAAAATCGGGCTTGACCGGCA
ACCAATTACCCATTGCCAAAATCGAAAAAGAAGGCAAGGGATTATCAGTGGCCACCGACTACATTCCTCC
CTGCACTACCCTTGGGGCACACGAAAGTTTGATTCATTTTTACAACGAATCGGAGAGCTTCCTAAAAATG
ACCGAGCGCAATGCCATTTTGATCGTTCAGAAAATCATGTCAAAACAAAGTGACAACCCCATTGCCGATG
CCATGAAATTAGTGGTCGACAAGATTTACGTATACCTTGCCCAACAGATTACCAAGGTGAAGTGGGAAGA
ACACGACATGCATCCTAGGGAATTGTTGCAAATCCTTGTAAGTTTTGCTCGGATATTCAAAGGATCCGTA
GATATATCGTCTCCTGAAAACAAAGAACAGCTCTTCAATTATTTTGGGGAATGGACAGACCTTAAGGGAG
GGGACTATGAAAAATTGTTCACTGACGTCATCAACCTACAGTACAATCATAACGACGTTAACGAAAACCT
TCAGGTAATCAACGTCTTTATGCAGACCATCGACAGGTTGCTCACCGTTCTCACCCAAGTCGATTATATC
GGTAAGCGTAGGGATATGGGCATCTTTGTTAACGAAAACATTGTAGAGGAAAAGCCTAGAAAATCTAGGG
GCACTTCATTTTTGGCCGAATAA