SecReT6
Protein ID: 340616416
SecReT6 ID920
T6SS typeiii
Gene symbol-
Locus tagzobellia_404
StrainZobellia galactanivorans DsiJT
Repliconchromosome [GenBank: NC_015844] [Browse all T6SS(s) in this replicon]
Location [Strand]539921..540430 [+]
Producthypothetical protein
NoteTssO
UniProt IDG0L9B9
KEGG IDzga:zobellia_404
PDB IDNA
Domain hit(s) vs Pfam FH2 [PF02181], Evalue: 0.0005, Aligned region: 56..79
FH2 [PF02181], Evalue: 0.0005, Aligned region: 117..165
Osmo_CC [PF08946], Evalue: 0.009, Aligned region: 66..77
Osmo_CC [PF08946], Evalue: 0.009, Aligned region: 138..156
Protein Sequence: 169 a.a.     [Download]
>gi|340616416|ref|YP_004734869.1| hypothetical protein zobellia_404 [Zobellia galactanivorans]
MEVLNKNERISSFLLFLLMFAISVGILFTAFFFSYKLPWKENEVLRAENQRIRYEFLYQKQFMTALEDID
KQIDSLDGAKDGYFFLEQSINADLIDLKSDIPKDSLDDRGMYENLILTYKKLVDAKRDLKQVESARMDIE
DLNEQIEEYEKEINKLNTALSLSQRLNRN
 
Nucleotide Sequence: 510 bp     [Download]
>gi|340616011|ref|NC_015844.1|:539921-540430 Zobellia galactanivorans chromosome, complete genome
ATGGAAGTACTTAATAAAAACGAACGCATCTCTTCTTTTCTGCTTTTCTTACTGATGTTCGCCATCTCGG
TAGGCATTCTTTTTACGGCTTTTTTCTTTAGCTATAAATTACCTTGGAAAGAAAACGAGGTACTCCGTGC
CGAAAACCAGAGAATACGCTATGAATTTTTATACCAAAAACAATTCATGACGGCATTGGAAGATATCGAC
AAACAAATTGATTCCCTAGACGGTGCCAAGGACGGTTATTTCTTTTTGGAGCAATCGATCAACGCTGATC
TTATCGACCTAAAAAGTGACATCCCGAAAGACTCCCTAGACGACAGGGGCATGTACGAAAACCTCATCCT
CACCTATAAAAAACTGGTCGATGCCAAGAGGGACCTAAAACAGGTAGAAAGTGCCAGAATGGATATTGAA
GACCTGAACGAGCAGATTGAGGAATACGAAAAAGAAATCAACAAGTTAAATACGGCATTGAGCCTTTCTC
AACGTTTGAACAGAAATTAA