SecReT6
Protein ID: 340616417
SecReT6 ID920
T6SS typeiii
Gene symbolclpB2
Locus tagzobellia_405
StrainZobellia galactanivorans DsiJT
Repliconchromosome [GenBank: NC_015844] [Browse all T6SS(s) in this replicon]
Location [Strand]540438..542903 [+]
Productchaperone ClpB
NoteClpV
UniProt IDG0L9C0
KEGG IDzga:zobellia_405
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.70E-44, Aligned region: 202..227
AAA_2 [PF07724], Evalue: 1.70E-44, Aligned region: 494..518
AAA_2 [PF07724], Evalue: 1.70E-44, Aligned region: 559..721
AAA [PF00004], Evalue: 8.60E-24, Aligned region: 205..335
AAA [PF00004], Evalue: 8.60E-24, Aligned region: 565..681
AAA_5 [PF07728], Evalue: 3.00E-16, Aligned region: 204..230
AAA_5 [PF07728], Evalue: 3.00E-16, Aligned region: 563..683
ClpB_D2-small [PF10431], Evalue: 2.90E-14, Aligned region: 734..808
AAA_16 [PF13191], Evalue: 1.10E-13, Aligned region: 64..133
AAA_16 [PF13191], Evalue: 1.10E-13, Aligned region: 183..227
AAA_16 [PF13191], Evalue: 1.10E-13, Aligned region: 248..289
AAA_16 [PF13191], Evalue: 1.10E-13, Aligned region: 390..418
AAA_16 [PF13191], Evalue: 1.10E-13, Aligned region: 534..600
Sigma54_activat [PF00158], Evalue: 4.90E-11, Aligned region: 187..224
Sigma54_activat [PF00158], Evalue: 4.90E-11, Aligned region: 561..668
AAA_18 [PF13238], Evalue: 7.50E-11, Aligned region: 205..322
AAA_18 [PF13238], Evalue: 7.50E-11, Aligned region: 411..435
AAA_18 [PF13238], Evalue: 7.50E-11, Aligned region: 565..589
AAA_14 [PF13173], Evalue: 2.40E-10, Aligned region: 201..322
AAA_14 [PF13173], Evalue: 2.40E-10, Aligned region: 565..659
AAA_22 [PF13401], Evalue: 2.60E-10, Aligned region: 203..314
AAA_22 [PF13401], Evalue: 2.60E-10, Aligned region: 561..587
AAA_17 [PF13207], Evalue: 2.80E-10, Aligned region: 205..293
AAA_17 [PF13207], Evalue: 2.80E-10, Aligned region: 435..442
AAA_17 [PF13207], Evalue: 2.80E-10, Aligned region: 564..600
IstB_IS21 [PF01695], Evalue: 2.60E-09, Aligned region: 197..325
IstB_IS21 [PF01695], Evalue: 2.60E-09, Aligned region: 564..586
Arch_ATPase [PF01637], Evalue: 1.20E-07, Aligned region: 184..225
Arch_ATPase [PF01637], Evalue: 1.20E-07, Aligned region: 255..352
Arch_ATPase [PF01637], Evalue: 1.20E-07, Aligned region: 429..487
Arch_ATPase [PF01637], Evalue: 1.20E-07, Aligned region: 566..592
RNA_helicase [PF00910], Evalue: 4.40E-07, Aligned region: 205..229
RNA_helicase [PF00910], Evalue: 4.40E-07, Aligned region: 471..490
RNA_helicase [PF00910], Evalue: 4.40E-07, Aligned region: 564..585
T2SE [PF00437], Evalue: 7.80E-07, Aligned region: 179..227
T2SE [PF00437], Evalue: 7.80E-07, Aligned region: 558..634
NACHT [PF05729], Evalue: 2.10E-06, Aligned region: 93..138
NACHT [PF05729], Evalue: 2.10E-06, Aligned region: 205..231
NACHT [PF05729], Evalue: 2.10E-06, Aligned region: 565..583
AAA_25 [PF13481], Evalue: 3.30E-05, Aligned region: 204..269
AAA_25 [PF13481], Evalue: 3.30E-05, Aligned region: 339..382
AAA_25 [PF13481], Evalue: 3.30E-05, Aligned region: 563..582
Zeta_toxin [PF06414], Evalue: 4.50E-05, Aligned region: 198..232
Zeta_toxin [PF06414], Evalue: 4.50E-05, Aligned region: 562..617
Sigma54_activ_2 [PF14532], Evalue: 6.70E-05, Aligned region: 57..97
Sigma54_activ_2 [PF14532], Evalue: 6.70E-05, Aligned region: 189..225
Sigma54_activ_2 [PF14532], Evalue: 6.70E-05, Aligned region: 545..586
ABC_tran [PF00005], Evalue: 8.40E-05, Aligned region: 203..231
ABC_tran [PF00005], Evalue: 8.40E-05, Aligned region: 565..601
Bac_DnaA [PF00308], Evalue: 0.00011, Aligned region: 205..369
Bac_DnaA [PF00308], Evalue: 0.00011, Aligned region: 560..586
MobB [PF03205], Evalue: 0.00013, Aligned region: 205..244
MobB [PF03205], Evalue: 0.00013, Aligned region: 565..589
NB-ARC [PF00931], Evalue: 0.00014, Aligned region: 187..224
NB-ARC [PF00931], Evalue: 0.00014, Aligned region: 323..374
NB-ARC [PF00931], Evalue: 0.00014, Aligned region: 553..596
DNA_pol3_delta2 [PF13177], Evalue: 0.00027, Aligned region: 42..96
DNA_pol3_delta2 [PF13177], Evalue: 0.00027, Aligned region: 198..229
DNA_pol3_delta2 [PF13177], Evalue: 0.00027, Aligned region: 555..658
AAA_10 [PF12846], Evalue: 0.00034, Aligned region: 203..226
AAA_10 [PF12846], Evalue: 0.00034, Aligned region: 369..437
AAA_10 [PF12846], Evalue: 0.00034, Aligned region: 562..595
PhoH [PF02562], Evalue: 0.00036, Aligned region: 183..229
PhoH [PF02562], Evalue: 0.00036, Aligned region: 563..582
ResIII [PF04851], Evalue: 0.00042, Aligned region: 190..225
ResIII [PF04851], Evalue: 0.00042, Aligned region: 535..584
Mg_chelatase [PF01078], Evalue: 0.0006, Aligned region: 191..224
Mg_chelatase [PF01078], Evalue: 0.0006, Aligned region: 562..585
AAA_19 [PF13245], Evalue: 0.00061, Aligned region: 201..227
AAA_19 [PF13245], Evalue: 0.00061, Aligned region: 564..586
DUF2075 [PF09848], Evalue: 0.00072, Aligned region: 204..236
DUF2075 [PF09848], Evalue: 0.00072, Aligned region: 563..588
Torsin [PF06309], Evalue: 0.00079, Aligned region: 200..226
Torsin [PF06309], Evalue: 0.00079, Aligned region: 519..587
PIF1 [PF05970], Evalue: 0.0013, Aligned region: 190..230
PIF1 [PF05970], Evalue: 0.0013, Aligned region: 540..588
AAA_28 [PF13521], Evalue: 0.0013, Aligned region: 205..232
AAA_28 [PF13521], Evalue: 0.0013, Aligned region: 392..429
AAA_28 [PF13521], Evalue: 0.0013, Aligned region: 564..582
CbiA [PF01656], Evalue: 0.0016, Aligned region: 205..228
CbiA [PF01656], Evalue: 0.0016, Aligned region: 565..596
DUF258 [PF03193], Evalue: 0.0016, Aligned region: 180..225
DUF258 [PF03193], Evalue: 0.0016, Aligned region: 564..582
AAA_33 [PF13671], Evalue: 0.0017, Aligned region: 205..225
AAA_33 [PF13671], Evalue: 0.0017, Aligned region: 564..582
AAA_24 [PF13479], Evalue: 0.0027, Aligned region: 201..224
AAA_24 [PF13479], Evalue: 0.0027, Aligned region: 567..585
TrwB_AAD_bind [PF10412], Evalue: 0.0034, Aligned region: 30..59
TrwB_AAD_bind [PF10412], Evalue: 0.0034, Aligned region: 196..226
TrwB_AAD_bind [PF10412], Evalue: 0.0034, Aligned region: 336..403
TrwB_AAD_bind [PF10412], Evalue: 0.0034, Aligned region: 562..595
AAA_29 [PF13555], Evalue: 0.0069, Aligned region: 201..219
AAA_29 [PF13555], Evalue: 0.0069, Aligned region: 237..253
AAA_29 [PF13555], Evalue: 0.0069, Aligned region: 562..577
DUF87 [PF01935], Evalue: 0.0081, Aligned region: 207..230
DUF87 [PF01935], Evalue: 0.0081, Aligned region: 409..425
DUF87 [PF01935], Evalue: 0.0081, Aligned region: 567..597
Protein Sequence: 821 a.a.     [Download]
>gi|340616417|ref|YP_004734870.1| chaperone ClpB [Zobellia galactanivorans]
MNTELEKAIHIATQIADEYQHDSFGPAHLVKATLHRDLSLLRFLHNKNVDVYFIEEWAEVRLEEYPKRTS
RSGDLKASPEAQLVFNEAEDIQQKLNKEEPDLICIFIAAITPGVGFTFDQLKSIPLSSNQLLDDLISQRK
TDKSGTVNTKTAPGSTPPKSDGVLYKYAKDLLEPAREGSYDHIVNRDRELKKIIEILSRKNKPNVIIQGE
SGVGKSVLAQNLAREIVGGKIVENLKDAHLFEIDTALLLSGASYKGEVEDRLQNIFDEAKALVKPIVFID
DFHFLLQDASSSQGILNVIKSELNKGEVILVGATNSDNYRKYISNDDALNRRFESVTLEEPDNEMAFRIL
QSIGQTYTDHHELQLTEDTLREAIRLSKRYLKEKSLPDSALDLLDRTMAAANVSEQSLPNDLEELKARME
AIEEKAEERDEAENIQEIDWVYMALRNKLSPIVLGKFDTEDAFGFPSYNEKSTYLKNIISAIDAHSKTPR
EAVLEEDLAAMVSSITGIPAGKVQTKEKERLMDMEDTLKKRVIGQDNAIKTVTEAIIESRSGLSKAGQPI
GSFFFSGPTGTGKTELAKSLAEFLFNDESAIIRFDMSEFKEEHSAALLYGAPPGYVGYEEGGVLVNKIRQ
KPYSIVLFDEIEKAHQSVFDVFLQILDEGKLSDRLGKVGDFSNAVILFTSNIGSEFISKAFEGGSVPKSD
ELLEIMASYFRPEFLGRITEIVPFAPISEKNAPTIFDLHLMKELLVLTERLGITLEIDKETKEHLSLDGF
SPTYGVRPLKAVIRNKLKRPLSKMIISGEIKAPQTVKVEMKNKEVVFSVVE
 
Nucleotide Sequence: 2466 bp     [Download]
>gi|340616011|ref|NC_015844.1|:540438-542903 Zobellia galactanivorans chromosome, complete genome
ATGAATACTGAATTGGAAAAGGCCATACACATCGCCACTCAAATTGCCGATGAATACCAACACGATAGTT
TCGGACCTGCACATCTGGTCAAAGCCACCCTTCATCGCGATTTATCGCTCTTACGTTTTTTGCATAACAA
GAACGTAGATGTGTATTTTATCGAGGAATGGGCCGAGGTTCGTTTAGAGGAATACCCAAAACGCACCAGC
CGATCGGGCGACCTTAAGGCAAGTCCGGAAGCACAACTTGTCTTTAACGAAGCCGAAGACATACAACAGA
AACTCAACAAGGAGGAACCCGACCTGATCTGCATCTTTATCGCCGCCATTACGCCCGGCGTAGGCTTTAC
CTTTGACCAGCTAAAGTCAATACCCCTGAGCAGTAACCAATTGCTCGACGACCTTATAAGCCAAAGAAAA
ACCGACAAATCGGGGACGGTCAATACAAAAACCGCCCCGGGAAGCACCCCTCCCAAATCTGACGGCGTAT
TATACAAGTACGCAAAAGACCTATTGGAACCGGCCCGCGAAGGCTCGTACGACCATATCGTAAACCGCGA
TAGGGAACTAAAGAAAATTATTGAGATCCTCAGCCGTAAAAACAAGCCGAATGTGATCATTCAAGGGGAA
TCGGGTGTAGGCAAAAGTGTTTTGGCCCAAAATTTGGCAAGGGAGATTGTCGGCGGAAAAATCGTTGAAA
ACCTAAAGGACGCCCATCTTTTTGAAATCGATACGGCCCTATTGCTCTCCGGTGCTTCATATAAAGGGGA
GGTCGAAGACCGCCTGCAAAACATTTTTGATGAAGCCAAGGCACTTGTAAAACCTATTGTCTTTATAGAC
GATTTCCATTTTCTTCTACAGGATGCCTCATCGAGCCAAGGAATTTTGAACGTCATCAAGTCTGAGCTGA
ACAAAGGCGAAGTCATTCTTGTAGGGGCGACCAACTCTGACAATTACAGAAAATATATCAGCAACGACGA
TGCGCTCAACAGGAGGTTTGAATCCGTCACCTTGGAAGAGCCCGATAACGAAATGGCCTTTAGGATCCTA
CAAAGTATCGGCCAAACCTATACCGACCATCACGAGTTGCAACTTACCGAAGATACCCTTCGCGAAGCGA
TACGATTGTCCAAAAGGTATTTAAAGGAAAAAAGCCTGCCCGATTCCGCCCTAGACTTATTGGACCGGAC
CATGGCTGCGGCCAATGTATCGGAGCAGTCCCTTCCCAACGACCTTGAGGAATTAAAGGCAAGGATGGAA
GCCATTGAGGAAAAAGCCGAAGAACGCGACGAAGCCGAGAACATTCAAGAAATCGACTGGGTCTATATGG
CCTTAAGGAATAAATTAAGCCCTATCGTACTCGGGAAATTCGACACCGAAGACGCCTTCGGATTTCCTTC
CTATAACGAAAAATCCACTTACCTTAAGAATATCATAAGCGCTATTGACGCGCACTCGAAAACACCCCGT
GAAGCCGTACTCGAAGAAGATCTGGCCGCCATGGTTTCGAGTATTACGGGAATACCCGCAGGCAAGGTAC
AGACCAAGGAAAAAGAACGTTTGATGGATATGGAGGACACCCTTAAGAAAAGGGTCATCGGCCAAGACAA
TGCCATTAAAACCGTTACCGAAGCTATTATAGAATCGCGTTCAGGACTTTCAAAAGCCGGACAACCTATC
GGCTCTTTCTTCTTTTCCGGACCCACGGGAACGGGAAAAACGGAATTGGCGAAATCATTGGCAGAATTTC
TTTTCAACGACGAAAGTGCGATCATTCGTTTTGACATGTCAGAATTTAAGGAAGAGCACTCTGCAGCCTT
GTTATACGGTGCGCCTCCGGGCTATGTCGGCTATGAAGAAGGCGGGGTCTTGGTCAATAAGATCAGGCAG
AAACCCTATTCCATTGTCTTATTCGATGAAATTGAAAAAGCCCACCAGTCGGTATTCGACGTATTTCTCC
AAATATTGGACGAAGGCAAACTCAGCGACCGTTTAGGCAAGGTAGGCGATTTTTCAAATGCGGTAATTCT
CTTTACCTCAAATATAGGCTCCGAATTTATAAGCAAGGCCTTCGAAGGGGGCTCCGTTCCAAAATCGGAC
GAGCTGCTCGAAATAATGGCCTCTTATTTTAGACCGGAATTTTTAGGACGTATTACAGAGATCGTCCCTT
TTGCACCCATCTCGGAAAAGAACGCCCCTACCATTTTCGACCTTCATTTAATGAAGGAATTATTGGTACT
TACCGAACGCTTGGGTATTACCCTTGAAATAGACAAGGAGACAAAAGAGCACCTATCATTAGACGGCTTC
TCCCCTACTTACGGGGTTCGACCACTTAAAGCGGTCATCCGGAACAAACTGAAAAGACCCCTATCGAAAA
TGATCATCTCCGGAGAAATCAAGGCGCCACAGACCGTAAAAGTGGAAATGAAAAATAAGGAGGTAGTTTT
TTCCGTTGTTGAATGA