SecReT6
Protein ID: 340616418
SecReT6 ID920
T6SS typeiii
Gene symbol-
Locus tagzobellia_406
StrainZobellia galactanivorans DsiJT
Repliconchromosome [GenBank: NC_015844] [Browse all T6SS(s) in this replicon]
Location [Strand]543087..543521 [+]
Producthypothetical protein
NoteTssE
UniProt IDG0L9C1
KEGG IDzga:zobellia_406
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.90E-08, Aligned region: 25..127
Protein Sequence: 144 a.a.     [Download]
>gi|340616418|ref|YP_004734871.1| hypothetical protein zobellia_406 [Zobellia galactanivorans]
MAKPYYQAPFDFKRFFEKKELKKIGMRDSISQFISVIITTYFEEYTFDEAFGSEIWETDFDLLINANVLK
ERIKKSLKNQIETYEKRLSNIDLNVELMESLSSNTNKVRLKKYLYITIKGTIIKTDEPFSFTGDYYLAPL
SYKH
 
Nucleotide Sequence: 435 bp     [Download]
>gi|340616011|ref|NC_015844.1|:543087-543521 Zobellia galactanivorans chromosome, complete genome
ATGGCAAAACCCTATTATCAGGCACCTTTTGATTTTAAGCGTTTTTTCGAGAAGAAAGAGCTCAAGAAAA
TCGGTATGCGCGACTCTATCTCCCAGTTTATTAGCGTGATCATTACGACCTATTTCGAGGAGTATACGTT
TGATGAAGCTTTTGGTAGTGAAATATGGGAAACCGATTTCGATCTTTTGATAAATGCCAACGTCCTTAAG
GAACGCATCAAAAAATCGCTGAAAAATCAGATTGAAACCTACGAAAAACGCCTTTCGAATATCGATTTGA
ACGTTGAGCTCATGGAAAGCCTGTCTTCCAACACCAACAAAGTAAGACTCAAAAAATATCTATATATCAC
TATTAAGGGGACCATTATAAAAACCGATGAGCCCTTTTCATTTACAGGGGATTATTACTTGGCTCCCTTG
TCGTACAAACATTGA