SecReT6
Protein ID: 340616419
SecReT6 ID920
T6SS typeiii
Gene symbol-
Locus tagzobellia_407
StrainZobellia galactanivorans DsiJT
Repliconchromosome [GenBank: NC_015844] [Browse all T6SS(s) in this replicon]
Location [Strand]543553..545421 [+]
Producthypothetical protein
NoteTssF
UniProt IDG0L9C2
KEGG IDzga:zobellia_407
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 622 a.a.     [Download]
>gi|340616419|ref|YP_004734872.1| hypothetical protein zobellia_407 [Zobellia galactanivorans]
MKSLSKEEIKDRLIRRAADTWGVDEMEIEYSFDPIVGILFDACSHEFERISETIKTSRTKITERLVDLLT
PEISVTAKPAHAVMHALPLDSQIEINGKTQFFNRKRMPLFNNFNGREGFTDFFFCPSGDFTLNNCELKYI
AYPDKIVSYGNQRSAPWLTKGDFSGAPESSAIYLGIQPGKDLKELKELLCYFDLLNFSNKELLVHHLGIA
EWSVNGMALEVTKGFPQKEAVRDDYSAYINEGIQSKIQFYEDYVRQYYEDHFYTIEGQVPLADNLKPHPE
IFKEFLSEKDIAMFQEPLLWIKISFSSVVSTPMLENLHCHINCFPILNKKTHSTSRRLQSYFNIIPMESE
NDFFLDVSHVEGDTGNKYYVHNRDKKDEVRPQAYLRFGGVSRFDERDASELLNYTLDLLKEDSVAFSAMG
DDFINSNLKDLKQIVSRIEQQIELRGFKKNKIPYLIINKNSINKNRDTIIYADYWTTSGEKANKINPYSK
LHQYSGTAFKPESLVLITGTLGGHDEPSPSEKIYAYREHILSRGRIITRQDIVQHCYAIFKDSITKVSIK
KGVMVSRDNSVGYTPTTDIYITQNSETNYSEDDWEHLKKELLIGIKTRSANVLPFRVFYTST
 
Nucleotide Sequence: 1869 bp     [Download]
>gi|340616011|ref|NC_015844.1|:543553-545421 Zobellia galactanivorans chromosome, complete genome
GTGAAAAGTCTATCCAAAGAGGAAATTAAAGATCGTCTAATCCGCAGGGCCGCTGACACTTGGGGGGTCG
ATGAAATGGAAATTGAATATTCATTCGATCCCATCGTCGGCATCCTTTTCGATGCTTGTTCGCATGAGTT
CGAACGCATATCGGAAACCATAAAGACCAGCCGAACCAAGATTACCGAGCGCTTGGTAGATCTTTTAACA
CCGGAAATATCGGTAACGGCCAAACCGGCCCATGCCGTCATGCACGCCCTACCCTTGGATTCGCAAATAG
AAATCAACGGAAAAACCCAATTCTTCAATAGAAAAAGAATGCCCTTGTTCAACAATTTCAATGGCAGGGA
AGGGTTTACCGATTTTTTCTTCTGTCCTTCGGGCGATTTTACCCTGAACAATTGTGAACTGAAATATATT
GCCTATCCCGACAAGATCGTATCCTACGGAAATCAAAGAAGTGCGCCGTGGCTCACGAAAGGCGATTTCT
CCGGTGCCCCGGAATCATCCGCCATATACCTAGGGATCCAGCCCGGTAAAGACCTAAAGGAATTAAAGGA
GCTTTTATGTTACTTTGACCTCCTCAATTTCTCGAACAAAGAACTATTGGTACACCACTTGGGCATTGCC
GAATGGTCCGTAAACGGTATGGCTTTGGAAGTTACCAAGGGATTCCCTCAAAAAGAGGCCGTTAGGGACG
ATTATAGTGCCTATATCAATGAAGGTATACAAAGTAAGATACAGTTTTATGAAGATTACGTAAGGCAGTA
TTACGAAGACCATTTTTACACCATTGAGGGCCAAGTGCCCTTGGCCGATAACTTGAAGCCACATCCGGAA
ATTTTCAAGGAGTTTTTATCGGAAAAAGATATCGCCATGTTCCAAGAGCCGCTTCTATGGATCAAAATTT
CCTTTTCTTCCGTGGTTTCCACCCCAATGTTGGAAAACCTGCATTGCCATATCAACTGTTTTCCCATATT
GAATAAAAAGACCCATAGCACCAGTAGGCGTTTACAGTCGTATTTCAATATTATCCCCATGGAATCGGAA
AATGATTTCTTTTTGGATGTCAGCCATGTGGAGGGCGATACCGGCAATAAGTATTATGTACATAACAGGG
ACAAAAAAGACGAGGTAAGGCCCCAGGCCTACTTGCGTTTTGGAGGGGTCAGCCGTTTTGACGAGCGCGA
TGCCTCCGAACTATTGAACTACACCTTAGACCTTTTAAAAGAAGACAGCGTGGCCTTCTCGGCCATGGGG
GACGACTTTATCAATTCGAATTTAAAAGACCTGAAACAGATCGTTTCCCGCATAGAACAACAAATAGAAC
TCCGCGGTTTTAAGAAAAATAAAATTCCTTATTTGATCATTAACAAGAACAGTATCAACAAAAATAGGGA
CACCATTATTTATGCCGATTATTGGACCACCTCAGGTGAAAAGGCCAACAAGATCAACCCCTACAGCAAG
CTGCACCAATATTCGGGAACGGCCTTTAAACCCGAATCATTGGTCTTGATCACGGGTACCTTGGGAGGGC
ACGACGAGCCGTCCCCAAGTGAAAAAATCTACGCCTACCGCGAACACATTCTCTCTAGGGGAAGAATAAT
AACCCGACAAGATATCGTTCAACATTGCTATGCGATTTTTAAGGATAGTATTACAAAGGTAAGCATCAAA
AAAGGCGTCATGGTTTCCCGTGACAATTCTGTGGGCTACACCCCTACGACCGATATATATATTACCCAAA
ATAGCGAGACCAATTATAGTGAAGATGATTGGGAACATCTGAAAAAAGAATTGTTGATAGGCATTAAAAC
GCGTTCGGCCAATGTATTGCCCTTCCGTGTTTTTTATACCTCAACTTGA