SecReT6
Protein ID: 340616420
SecReT6 ID920
T6SS typeiii
Gene symbol-
Locus tagzobellia_408
StrainZobellia galactanivorans DsiJT
Repliconchromosome [GenBank: NC_015844] [Browse all T6SS(s) in this replicon]
Location [Strand]545524..547359 [+]
ProductVgr family protein
NoteVgrG
UniProt IDG0L9C3
KEGG IDzga:zobellia_408
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.60E-20, Aligned region: 57..337
Phage_base_V [PF04717], Evalue: 1.70E-14, Aligned region: 372..449
DUF2345 [PF10106], Evalue: 0.00022, Aligned region: 93..143
DUF2345 [PF10106], Evalue: 0.00022, Aligned region: 492..527
DUF2345 [PF10106], Evalue: 0.00022, Aligned region: 526..609
DUF3540 [PF12059], Evalue: 0.0038, Aligned region: 242..286
DUF3540 [PF12059], Evalue: 0.0038, Aligned region: 495..550
DUF3540 [PF12059], Evalue: 0.0038, Aligned region: 578..610
Protein Sequence: 611 a.a.     [Download]
>gi|340616420|ref|YP_004734873.1| Vgr family protein [Zobellia galactanivorans]
MSKIVNSKLLVGGEEFLPNSGYSVTVEQSIGGHSAFRIAFPSNATEGYAGALMDNALAYVGKKITIGINE
NQMEFKGVVTSVDLQKGADAAGTIVLSGHGPAALLANSVQCLSYEEGTPLSQVATDTVNGHSTEHVKLSI
GKGTDVSLPYTVQYNESDLAFLQRLCSRYGAWIYHNGTDFCVGRTGDKQVHGIYGQDVQGFNLSTVLREQ
SFGLKARDWVNDTDLEADASAFAPSSSHPYQDRIKGESQNVFAKRSSYDWSVGQHEYSAQSGVDTATKVN
AMGKAASMILASGTSELVGLRVGDTLTLEGLNFSDQGKKDPYGSYDITKVVHRFDHSGHYRNEFEGVPEG
TEHLPYSNSFAAPRSGAQRGWVLDNADPEGLGRIKVQFPWQRPMGTSTPWIKMATPYSGSDKGFYFIPEK
EEEVLVGFEADNPEKPFVLSAGFNSSAKSGLADADNNIKAIKTRSGHIIELNDTDGGESITIKDKNENIF
QIDTASNDITINANNNVNVNAENNVTLTAKETIKFSAKNIQLDAQEDITAGASRNISASAGETVNTMAKN
KNDIIDNEIMINAKKLEETADEISVNSTSKNLTLFSQKSVDVQSNEKVKLF
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|340616011|ref|NC_015844.1|:545524-547359 Zobellia galactanivorans chromosome, complete genome
ATGTCCAAAATAGTAAACAGCAAACTCCTTGTAGGAGGAGAGGAATTCTTGCCCAATTCGGGCTATAGCG
TTACCGTAGAACAGTCCATTGGAGGGCACAGCGCCTTCCGTATCGCCTTCCCTTCCAATGCCACCGAAGG
CTACGCGGGCGCCTTGATGGACAATGCCCTGGCCTATGTGGGCAAGAAGATCACCATCGGCATCAACGAA
AACCAAATGGAATTCAAGGGCGTGGTCACCTCGGTAGACCTCCAAAAGGGGGCCGATGCCGCAGGTACCA
TCGTACTGTCGGGCCATGGGCCGGCGGCCCTCTTGGCCAATTCCGTCCAGTGCCTTAGCTACGAAGAGGG
TACGCCCCTATCTCAGGTGGCTACCGATACCGTGAACGGACATTCCACCGAACATGTAAAACTTTCCATC
GGCAAGGGCACCGACGTAAGCCTGCCCTATACCGTACAATATAACGAGAGCGACCTGGCCTTCCTTCAAC
GGCTCTGCAGCCGCTATGGGGCCTGGATCTACCATAACGGCACCGATTTCTGCGTGGGCAGGACCGGGGA
CAAACAGGTGCACGGCATTTACGGACAAGATGTACAGGGCTTTAACCTTTCCACCGTGCTCAGGGAGCAG
TCCTTCGGACTTAAGGCCAGGGACTGGGTCAACGACACCGATCTGGAAGCCGATGCATCGGCCTTCGCCC
CAAGCTCGTCACACCCCTACCAAGACCGGATAAAGGGCGAATCGCAAAACGTTTTCGCCAAGAGAAGTTC
CTATGATTGGAGCGTAGGCCAGCACGAATACAGTGCGCAAAGCGGCGTAGATACCGCCACAAAGGTCAAC
GCCATGGGAAAGGCGGCCAGTATGATATTGGCCTCGGGCACTTCGGAGCTCGTGGGCCTTCGCGTCGGCG
ATACCCTCACCTTGGAAGGGCTCAATTTTTCCGACCAGGGCAAAAAGGACCCCTACGGTTCCTATGATAT
CACCAAGGTCGTACACAGGTTCGACCATAGCGGACATTACCGCAACGAGTTCGAGGGCGTGCCCGAGGGC
ACCGAACACCTGCCCTACTCCAACAGTTTTGCCGCTCCCCGATCGGGCGCGCAAAGGGGCTGGGTGCTCG
ACAATGCCGATCCGGAAGGACTCGGACGTATCAAGGTGCAGTTCCCCTGGCAGAGGCCCATGGGTACCAG
TACACCCTGGATAAAGATGGCCACCCCCTACTCCGGTAGCGACAAGGGCTTTTACTTCATCCCCGAAAAG
GAAGAAGAGGTCTTGGTCGGTTTCGAGGCCGACAACCCCGAAAAGCCCTTTGTACTCAGTGCCGGCTTTA
ACAGCAGTGCCAAAAGCGGCCTGGCCGATGCCGACAACAACATCAAGGCCATCAAGACCCGTAGCGGGCA
TATCATAGAGCTCAACGATACCGACGGTGGGGAGAGCATTACGATCAAGGATAAGAATGAGAATATTTTT
CAGATCGATACGGCGAGTAACGACATTACCATCAATGCGAATAACAATGTAAATGTTAATGCAGAAAATA
ACGTTACGCTTACCGCCAAGGAAACCATAAAATTTTCAGCTAAAAATATACAATTAGACGCACAGGAAGA
TATTACGGCCGGAGCAAGTAGAAATATTAGTGCTAGTGCTGGAGAAACCGTCAATACCATGGCCAAAAAC
AAAAATGATATTATCGACAACGAAATTATGATCAATGCTAAAAAATTAGAAGAAACTGCTGACGAAATCT
CCGTGAACAGTACATCCAAAAATTTGACTTTATTTTCTCAAAAATCTGTTGATGTACAAAGCAATGAAAA
GGTAAAATTATTTTAA