SecReT6
Protein ID: 340785258
SecReT6 ID455
T6SS typei4b
Gene symbolimpA
Locus tagCFU_0061
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]89133..90302 [-]
Producthypothetical protein
NoteTssA
UniProt IDG0A7Y9
KEGG IDcfu:CFU_0061
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.00E-22, Aligned region: 82..143
ImpA-rel_N [PF06812], Evalue: 3.00E-22, Aligned region: 236..250
Protein Sequence: 389 a.a.     [Download]
>gi|340785258|ref|YP_004750723.1| hypothetical protein CFU_0061 [Collimonas fungivorans Ter331]
MCQGNSDEYLARASPLAGLNHFYLDLSFMFSVDQLLNPVSDAAPCGADLSFSSDLDAIANARRFDDPSLD
QGEWVTELKEADWGFVVDNCARLIETQSKDLRLAVWLAEANAKVRHFGGLADGYLLLAGLSDRYWESLHP
VPDDDDQELRVGNLSWLLSRSVHLIREIPITEGRGTAFSTVDFESARIRAASEERDRANGESVNSEGVKL
ADIEAAKRKSSPKFYEKLLADASLCQQALLQLEKSIDFRVGDDGPAFSAAKDTLENVIAVITRFAQEAGV
NTGSAPKASNETQTAPTVQQEVSKVEQAQATLNGPIQNRAQALAQLRHVADFFRRTEPHSPVAYLADKAA
SWGDLPLHHWLRTVIKDPGSLAHVEELLGLHGNQQNDEN
 
Nucleotide Sequence: 1170 bp     [Download]
>gi|340785197|ref|NC_015856.1|:c90302-89133 Collimonas fungivorans Ter331 chromosome, complete genome
TTGTGCCAAGGAAATTCTGATGAATATCTCGCAAGAGCGTCGCCGCTTGCCGGCTTGAATCACTTTTATT
TGGATTTGTCATTTATGTTTTCTGTCGATCAATTACTCAATCCTGTCAGCGACGCCGCACCGTGCGGCGC
CGACCTGTCTTTCTCAAGCGACCTGGATGCGATTGCCAACGCCCGGCGCTTTGACGATCCGTCGCTCGAT
CAAGGCGAATGGGTCACCGAGCTCAAGGAGGCGGACTGGGGTTTCGTCGTCGACAATTGCGCGCGGCTGA
TCGAAACCCAGAGCAAGGATCTGCGGCTGGCGGTCTGGCTGGCGGAAGCCAACGCCAAGGTGCGCCATTT
CGGCGGCCTGGCCGACGGTTACCTGCTGCTGGCCGGCTTGAGCGACAGGTATTGGGAAAGCTTGCATCCG
GTGCCGGATGACGACGACCAGGAATTGCGGGTCGGCAATCTGAGCTGGCTGTTGTCGCGCTCGGTGCACC
TGATCCGCGAAATCCCGATCACGGAAGGCCGCGGCACCGCTTTTTCCACCGTCGATTTCGAATCGGCGCG
CATCCGAGCAGCCAGTGAAGAACGCGACAGGGCCAACGGCGAGAGCGTCAACAGCGAAGGCGTCAAGCTG
GCCGACATCGAAGCGGCAAAACGCAAATCGTCGCCGAAGTTTTATGAAAAATTATTGGCCGATGCCAGCT
TGTGCCAGCAAGCGCTGCTGCAGCTGGAAAAGTCGATCGATTTCCGCGTGGGTGACGATGGCCCGGCTTT
TTCAGCAGCCAAGGACACCCTGGAAAATGTGATTGCGGTCATTACCCGCTTCGCCCAGGAAGCCGGGGTC
AATACAGGCAGCGCGCCGAAAGCCAGCAACGAAACACAAACCGCACCCACGGTGCAGCAGGAGGTAAGCA
AGGTGGAGCAAGCACAGGCCACGCTGAACGGTCCGATACAGAACCGCGCCCAGGCCCTGGCGCAACTGCG
CCATGTGGCCGATTTTTTCCGCCGCACCGAGCCCCACAGCCCGGTCGCCTACCTGGCGGACAAGGCCGCC
AGCTGGGGCGACCTGCCGCTGCATCACTGGCTGCGCACGGTCATCAAGGATCCCGGCTCGCTGGCGCACG
TGGAAGAACTGCTCGGACTGCACGGCAACCAGCAGAACGACGAAAACTAG