SecReT6
Protein ID: 340785260
SecReT6 ID455
T6SS typei4b
Gene symbolvrgS
Locus tagCFU_0063
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]91425..93674 [+]
Producthypothetical protein
NoteTssI
UniProt IDG0A7Z1
KEGG IDcfu:CFU_0063
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-77, Aligned region: 44..351
Phage_GPD [PF05954], Evalue: 2.20E-77, Aligned region: 624..658
Phage_base_V [PF04717], Evalue: 1.40E-24, Aligned region: 390..482
Protein Sequence: 749 a.a.     [Download]
>gi|340785260|ref|YP_004750725.1| hypothetical protein CFU_0063 [Collimonas fungivorans Ter331]
MPMYPNPSAMLARVGRFNQDRRLVRIKTPLDADLLLVHRMYGSEALSKPFQLTLELLSPYDQLELKQLVG
QPVLLTMQTAGDERHFHGFVQEFSRTGSDGGLATYQAQLAPWFSFLDYASNCRVFQDQSVLDIAQEVFSK
YGQLADYRFDLVAGRYPKLPYCVQYNESDFTFVSRLLEDAGIYYSFEHSESGHKLVLADDSTQCKPLEGD
ATVRFQPNQELQASDVLDDWRPRRRVGPSVHSIKSFDFKQPRNPLAVELKNDAPRGTLPQFEHYAYDGAA
SYGNSSVGEQLTAVRAEEAGWQTKVFEGAGTTRVLAIGRYFDLSGHFEHEDDDQTEHRFTALQVKHDARN
NFSSDFSEAQDCMYRVEVSALRRKIPYRPLRETAKPRMPGPQTATVVGPKGEEIWHDKYGRVKLQFHWDR
LGQFNDQSSCWVRVASPWAGSGMGGVSAPRVGQEVVVDFLDGNPDRPIITGRVYNADNMPPFGQEVSGMR
SKTVRGGGFNEVTMHDTGGSELLNMHAQRDMAVTVLNDHNSTVKNNKATKVAVNHSLNVGANQDISVGGN
RGATVTGNDTRTVTGTSTATVTGAVTQTYQAGQKRTITAAGYNENITGDYGSTLVGNYSGSTSGNWKRAI
TGTATRTITGAVSDTMHAGREVTVTGTDKRTVTGAVEDGNTGARLLSVTGNMQHEVSGTHSVYSGSDQTI
TSGSKVDLIVGGAGISIVGSEIVITAGGSTIKINGSGVSINGSKINLNS
 
Nucleotide Sequence: 2250 bp     [Download]
>gi|340785197|ref|NC_015856.1|:91425-93674 Collimonas fungivorans Ter331 chromosome, complete genome
ATGCCAATGTATCCAAACCCTTCTGCAATGCTGGCCCGGGTAGGCCGCTTCAACCAGGACCGGCGCCTGG
TCCGGATCAAGACCCCGTTGGATGCCGACCTGCTGCTGGTGCATCGGATGTACGGCAGCGAAGCATTGTC
CAAGCCGTTCCAGCTGACGCTGGAATTGCTGTCGCCGTACGACCAGCTTGAACTCAAGCAGCTGGTCGGA
CAGCCGGTGCTGCTGACCATGCAGACCGCCGGCGACGAGCGCCATTTCCATGGTTTCGTGCAGGAATTCA
GCCGCACCGGCAGCGACGGCGGCCTGGCCACTTACCAGGCGCAGCTGGCGCCATGGTTTTCCTTCCTCGA
CTACGCCAGCAACTGCCGCGTGTTCCAGGACCAGTCGGTGCTCGATATCGCGCAGGAAGTGTTCAGCAAG
TACGGCCAGCTGGCCGACTATCGCTTCGACCTGGTTGCCGGCCGCTATCCAAAACTGCCGTACTGCGTGC
AGTACAACGAATCCGATTTCACTTTCGTTTCGCGCCTGCTGGAAGATGCCGGGATCTACTACAGCTTCGA
GCACAGCGAGAGCGGCCACAAGCTGGTGCTGGCCGACGACTCCACCCAATGCAAGCCGCTGGAAGGCGAC
GCCACCGTGCGTTTCCAGCCCAACCAGGAATTGCAGGCCAGCGACGTGCTGGACGACTGGCGGCCGCGGC
GCCGGGTCGGGCCCTCGGTGCACAGCATCAAGAGTTTCGATTTCAAGCAGCCGCGCAATCCCCTCGCGGT
CGAACTGAAGAATGATGCGCCGCGCGGCACCCTGCCGCAGTTCGAACACTATGCTTACGATGGTGCGGCC
AGTTACGGCAACAGCTCGGTCGGCGAACAGCTGACCGCGGTGCGGGCCGAGGAAGCCGGCTGGCAGACCA
AGGTGTTTGAGGGAGCCGGCACTACCCGGGTGCTGGCGATCGGCCGTTATTTCGACCTCAGCGGCCATTT
CGAGCACGAGGACGACGACCAGACCGAACATCGCTTCACGGCGCTGCAGGTCAAGCACGATGCCCGCAAC
AATTTCTCCAGCGATTTCAGCGAAGCCCAGGATTGCATGTACCGGGTCGAGGTCAGCGCCTTGCGCCGCA
AGATTCCCTACCGGCCCTTGCGCGAGACCGCCAAGCCGCGTATGCCGGGGCCGCAGACGGCGACCGTGGT
GGGACCGAAAGGCGAGGAGATCTGGCACGACAAATACGGCCGCGTGAAATTGCAGTTCCACTGGGACCGT
CTGGGCCAGTTCAATGACCAGAGCTCTTGCTGGGTGCGGGTCGCCAGCCCTTGGGCCGGCAGCGGCATGG
GCGGGGTTTCGGCGCCGCGCGTCGGGCAGGAAGTGGTGGTTGATTTCCTCGACGGCAATCCGGACCGGCC
TATCATCACCGGCCGCGTCTACAACGCCGACAACATGCCGCCGTTCGGCCAGGAAGTCAGCGGCATGCGC
TCCAAGACGGTGCGCGGCGGCGGCTTCAACGAAGTCACCATGCACGACACCGGCGGCAGCGAGCTGCTCA
ACATGCATGCCCAGCGCGACATGGCGGTGACGGTGCTGAACGACCATAACAGCACCGTCAAGAACAACAA
GGCGACCAAGGTGGCCGTCAACCACAGCCTGAATGTCGGCGCCAACCAGGATATTTCGGTGGGTGGCAAC
CGCGGCGCAACGGTCACCGGCAACGATACCCGCACCGTCACCGGCACCTCCACCGCCACCGTTACCGGCG
CGGTGACGCAAACCTACCAGGCAGGCCAGAAACGCACCATCACTGCCGCCGGTTATAACGAAAACATCAC
CGGCGACTACGGCAGCACCCTGGTCGGCAACTATAGCGGCAGCACCAGCGGCAACTGGAAGCGCGCCATC
ACCGGCACCGCCACCCGCACCATCACCGGTGCGGTCAGCGACACCATGCATGCCGGCCGCGAAGTGACGG
TGACCGGCACCGACAAGCGTACCGTGACCGGCGCGGTGGAAGACGGCAATACCGGCGCGCGCCTGTTGTC
CGTGACCGGCAACATGCAGCACGAAGTGTCCGGCACTCATAGCGTGTATTCCGGCTCCGACCAGACAATT
ACCTCGGGCAGCAAGGTTGATCTTATTGTCGGCGGCGCCGGCATCAGTATCGTAGGCAGCGAAATCGTCA
TCACCGCAGGCGGCTCGACCATCAAGATCAACGGCAGCGGCGTGTCGATCAACGGCAGCAAGATCAACCT
GAACAGCTGA