SecReT6
Protein ID: 340785265
SecReT6 ID455
T6SS typei4b
Gene symbolclpB
Locus tagCFU_0068
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]101108..103807 [-]
ProductClpB protein
NoteTssH
UniProt IDG0A7Z6
KEGG IDcfu:CFU_0068
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.20E-45, Aligned region: 232..331
AAA_2 [PF07724], Evalue: 8.20E-45, Aligned region: 628..798
AAA [PF00004], Evalue: 2.70E-19, Aligned region: 233..346
AAA [PF00004], Evalue: 2.70E-19, Aligned region: 634..756
AAA_5 [PF07728], Evalue: 2.00E-14, Aligned region: 233..256
AAA_5 [PF07728], Evalue: 2.00E-14, Aligned region: 633..754
ClpB_D2-small [PF10431], Evalue: 6.30E-13, Aligned region: 804..881
Clp_N [PF02861], Evalue: 3.60E-11, Aligned region: 23..71
Clp_N [PF02861], Evalue: 3.60E-11, Aligned region: 111..125
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 210..263
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 277..311
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 492..551
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 627..657
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 699..722
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 232..319
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 630..654
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 695..727
Sigma54_activat [PF00158], Evalue: 1.90E-06, Aligned region: 215..313
Sigma54_activat [PF00158], Evalue: 1.90E-06, Aligned region: 632..749
AAA_17 [PF13207], Evalue: 9.10E-06, Aligned region: 80..106
AAA_17 [PF13207], Evalue: 9.10E-06, Aligned region: 233..296
AAA_17 [PF13207], Evalue: 9.10E-06, Aligned region: 633..669
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 232..280
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 414..456
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 487..508
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 615..652
AAA_29 [PF13555], Evalue: 3.70E-05, Aligned region: 225..249
AAA_29 [PF13555], Evalue: 3.70E-05, Aligned region: 628..658
IstB_IS21 [PF01695], Evalue: 3.90E-05, Aligned region: 227..258
IstB_IS21 [PF01695], Evalue: 3.90E-05, Aligned region: 431..466
IstB_IS21 [PF01695], Evalue: 3.90E-05, Aligned region: 633..651
AAA_19 [PF13245], Evalue: 0.0002, Aligned region: 233..257
AAA_19 [PF13245], Evalue: 0.0002, Aligned region: 630..655
ResIII [PF04851], Evalue: 0.00034, Aligned region: 217..255
ResIII [PF04851], Evalue: 0.00034, Aligned region: 295..314
ResIII [PF04851], Evalue: 0.00034, Aligned region: 604..653
DUF2075 [PF09848], Evalue: 0.00036, Aligned region: 233..335
DUF2075 [PF09848], Evalue: 0.00036, Aligned region: 632..654
NACHT [PF05729], Evalue: 0.00056, Aligned region: 233..261
NACHT [PF05729], Evalue: 0.00056, Aligned region: 634..654
Zeta_toxin [PF06414], Evalue: 0.0019, Aligned region: 233..254
Zeta_toxin [PF06414], Evalue: 0.0019, Aligned region: 626..673
SRP54 [PF00448], Evalue: 0.0025, Aligned region: 233..257
SRP54 [PF00448], Evalue: 0.0025, Aligned region: 632..664
Arch_ATPase [PF01637], Evalue: 0.0026, Aligned region: 283..382
Arch_ATPase [PF01637], Evalue: 0.0026, Aligned region: 497..497
Arch_ATPase [PF01637], Evalue: 0.0026, Aligned region: 630..672
Arch_ATPase [PF01637], Evalue: 0.0026, Aligned region: 704..727
DUF258 [PF03193], Evalue: 0.005, Aligned region: 227..253
DUF258 [PF03193], Evalue: 0.005, Aligned region: 631..645
MobB [PF03205], Evalue: 0.0071, Aligned region: 14..41
MobB [PF03205], Evalue: 0.0071, Aligned region: 234..257
MobB [PF03205], Evalue: 0.0071, Aligned region: 632..665
RNA_helicase [PF00910], Evalue: 0.0082, Aligned region: 234..256
RNA_helicase [PF00910], Evalue: 0.0082, Aligned region: 634..655
RNA_helicase [PF00910], Evalue: 0.0082, Aligned region: 733..752
AAA_18 [PF13238], Evalue: 0.0085, Aligned region: 233..261
AAA_18 [PF13238], Evalue: 0.0085, Aligned region: 482..505
AAA_18 [PF13238], Evalue: 0.0085, Aligned region: 635..658
T2SE [PF00437], Evalue: 0.0096, Aligned region: 219..256
T2SE [PF00437], Evalue: 0.0096, Aligned region: 624..670
T2SE [PF00437], Evalue: 0.0096, Aligned region: 816..843
Protein Sequence: 899 a.a.     [Download]
>gi|340785265|ref|YP_004750730.1| ClpB protein [Collimonas fungivorans Ter331]
MSINLKTLISKLNDTSRLAAERAANICVGRGQYEVDIEHLFLALLEQPKSDFAVIARKSGISLAALESDL
QGEIDRFKNGNARTPVFSPHLPKLFEHAWLIASLDNQSGRIRSGHLLLALLTEPDLVQLAYRGSKLFIKF
KLDDLKHDLEKLTEGSQESAAVNGDGTAATEDEGGDPVQDLTGEASKTPSLDKFTTNLTQRAREGKVDPV
IGRDTEIRQTIDILMRRRQNNPILTGEAGVGKTAVVEGLALRIAQKDVPDVLQGVEVHTLDMGLLQAGAS
VKGEFENRLKSVIDEVKKSSHAIILFIDEAHTMIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYK
KYFEKDAALARRFQVVKVEEPSEELACAMLRGMAPLMEKHFGVRVFDEAITEAVRLSHRYISGRQLPDKA
ISVLDTACAKVALGQNATPALIENIVKKLDRLVAELNSLERESNAGGKHAERLKELRELQSTLNAELAIH
RERWEKEKTLTDRIKAARTELEAIPAAEQTAAEEGAKPSKKAAKDSKENQELAKLIEELKTLQGETPMVP
VQVDGLVVAEIVASWTGIPLGKMVKDEIKTVINLGALLHERVLGQPHAIEAVAQRVRTSRANLDDPNKPK
GVFLFVGPSGVGKTETALALADVLYGGERKLVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRR
NPYSVVLLDEVEKAHPDVLELFFQVFDKGVLDDAEGREIDFKNTIIILTSNVASSLIMQSCLNKAAAELP
STDDLEQAIRPQLVKAFKPAFLGRLKVIPYYPISDDVLVEIINLKLGRIQKRIAINHKAEFSYDEPLVEA
VLARCTEVDSGARNVDNILNGTLLPEIAETVLAKMAEGGSIAKIKVTANKQGQFKYAIK
 
Nucleotide Sequence: 2700 bp     [Download]
>gi|340785197|ref|NC_015856.1|:c103807-101108 Collimonas fungivorans Ter331 chromosome, complete genome
ATGAGCATTAATCTCAAAACCTTAATCAGCAAACTGAACGATACCTCGCGCCTGGCGGCAGAACGTGCGG
CAAACATCTGCGTCGGCCGTGGGCAGTATGAAGTGGATATCGAACACCTGTTCCTGGCCCTGCTGGAACA
GCCCAAGAGCGATTTTGCAGTGATTGCGCGCAAATCCGGCATCAGCCTGGCCGCGCTGGAAAGCGACCTG
CAGGGTGAAATCGACCGTTTCAAGAACGGCAACGCGCGCACCCCGGTCTTTTCGCCGCACCTGCCCAAGC
TGTTCGAACACGCCTGGCTGATCGCCTCGCTCGACAACCAGTCGGGACGGATCCGCAGCGGCCATCTGCT
GCTGGCGCTGCTGACCGAGCCGGACCTGGTGCAGCTGGCCTATCGCGGCTCCAAGCTGTTCATCAAGTTC
AAGCTGGACGATCTCAAGCACGACCTCGAAAAGTTGACTGAAGGTTCGCAGGAAAGCGCAGCCGTCAATG
GCGACGGCACTGCCGCAACTGAAGACGAAGGCGGCGATCCGGTACAGGACCTGACCGGCGAAGCCTCGAA
AACCCCCTCGCTCGACAAATTCACTACCAACCTGACGCAGCGCGCGCGCGAAGGCAAGGTCGACCCGGTG
ATCGGCCGCGATACCGAAATCCGCCAGACCATCGACATCCTGATGCGGCGCCGCCAAAACAATCCGATCC
TGACCGGCGAGGCCGGCGTCGGCAAAACCGCCGTGGTGGAAGGCCTGGCGCTGCGCATTGCGCAAAAAGA
CGTGCCAGACGTGCTGCAAGGCGTGGAAGTGCATACGCTCGACATGGGCCTGCTGCAAGCCGGAGCCAGC
GTCAAGGGCGAGTTTGAAAACCGCCTGAAAAGCGTGATCGACGAGGTCAAGAAAAGCTCGCACGCCATCA
TCCTGTTCATCGACGAAGCCCACACCATGATCGGCGCCGGCGGCCAGGCTGGCCAGAACGATGCCGCCAA
CCTGCTGAAACCGGCGCTGGCGCGCGGCGAGCTGCGCACCATCGCCGCCACCACCTGGAGCGAGTACAAG
AAATATTTCGAAAAAGACGCTGCCCTGGCGCGTCGCTTCCAAGTCGTGAAAGTCGAGGAACCGAGCGAAG
AACTGGCTTGTGCGATGCTGCGCGGCATGGCGCCGCTGATGGAAAAACACTTCGGCGTGCGTGTCTTCGA
CGAAGCGATCACCGAGGCCGTGCGTTTATCGCACCGCTATATCAGCGGCCGCCAGCTGCCGGACAAGGCG
ATCAGCGTGCTCGACACCGCCTGCGCCAAGGTTGCGCTGGGCCAGAATGCAACGCCGGCCCTGATCGAAA
ATATCGTCAAGAAGCTGGATCGCCTGGTGGCAGAACTGAACTCGCTGGAGCGCGAATCGAACGCCGGCGG
CAAGCATGCCGAACGCCTGAAGGAATTGCGCGAACTGCAAAGCACATTGAATGCGGAACTGGCGATCCAC
CGCGAACGCTGGGAAAAGGAAAAAACCCTGACCGACCGCATCAAGGCCGCCCGTACCGAACTGGAAGCGA
TCCCCGCTGCCGAACAAACCGCGGCGGAAGAAGGCGCCAAGCCTTCCAAGAAAGCCGCCAAGGACAGCAA
GGAAAACCAGGAACTGGCGAAGCTGATCGAGGAATTGAAAACGCTGCAAGGCGAAACGCCGATGGTGCCG
GTGCAGGTCGACGGCCTGGTGGTGGCGGAAATCGTCGCCAGCTGGACCGGCATCCCGCTCGGCAAGATGG
TCAAGGATGAAATCAAGACCGTGATCAATCTCGGCGCCCTGCTGCACGAACGCGTGCTCGGTCAGCCGCA
TGCCATCGAAGCCGTGGCGCAGCGAGTACGCACTTCGCGCGCCAACCTGGACGATCCGAACAAACCCAAG
GGCGTGTTCCTGTTCGTCGGCCCGTCCGGCGTCGGCAAGACCGAAACCGCGCTGGCGCTGGCCGACGTGC
TGTACGGCGGCGAACGCAAGCTGGTCACCATCAACATGAGCGAATACCAGGAAGCGCACAGCGTCTCCGG
CCTGAAAGGCTCGCCGCCGGGATATGTCGGCTATGGCGAAGGCGGCGTCCTGACCGAAGCGGTGCGGCGC
AATCCGTACAGCGTAGTGCTGCTGGACGAGGTGGAAAAAGCCCATCCGGATGTGCTCGAGCTGTTTTTCC
AGGTGTTCGACAAGGGCGTGCTGGACGACGCCGAGGGCCGCGAGATCGACTTCAAGAACACCATCATCAT
CCTCACCAGCAATGTTGCCTCCAGCCTGATCATGCAGAGCTGCCTGAACAAGGCGGCGGCGGAACTGCCG
AGCACCGACGACCTGGAACAGGCGATCCGGCCGCAGCTGGTTAAGGCGTTCAAGCCGGCCTTCCTCGGTC
GCCTGAAAGTGATTCCTTACTACCCGATTTCGGACGACGTGCTGGTCGAGATCATCAATCTCAAGCTGGG
ACGCATCCAGAAACGCATCGCCATCAACCACAAGGCCGAGTTCAGCTACGACGAACCGCTGGTGGAAGCG
GTGCTGGCGCGCTGTACGGAAGTCGATTCCGGCGCCCGCAATGTCGACAATATCCTCAACGGCACGCTGT
TGCCGGAAATTGCCGAAACGGTGCTGGCCAAGATGGCCGAAGGCGGCAGCATCGCCAAGATCAAGGTCAC
TGCCAACAAGCAAGGCCAATTCAAATACGCGATCAAATAG