SecReT6
Protein ID: 340785266
SecReT6 ID455
T6SS typei4b
Gene symbolimpH
Locus tagCFU_0069
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]103832..104914 [-]
Producthypothetical protein
NoteTssG
UniProt IDG0A7Z7
KEGG IDcfu:CFU_0069
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-81, Aligned region: 18..341
Protein Sequence: 360 a.a.     [Download]
>gi|340785266|ref|YP_004750731.1| hypothetical protein CFU_0069 [Collimonas fungivorans Ter331]
MLTAQRRFEPSVIQRLLDKPHRFQFFQAVMMLELWLKRNGIPHEEAVSDFLRFQNTVSLNFPPSEIEALE
VTPKLTEQTVEALLDALQTNQLDSIALTPAFIGFLGSNGTLPSHYSERIAAHQLYEKDHGPRAFLDVFSN
RSVALFFKAWRKYRLEFKYQIDGTDSFLPLLMSLAGLGHRTLRDRMSEDGAGVLDESIGHFAAAIRHRPP
SAAYMQRVLREYFSVPITIEQFVGHWYNVPVDQQTVLGSTNALLGSVAMVGERVWQRDLRMRLKIGPLAK
KKFESFLPGGAAAIGLQKILAMFTSVFLEYEIQLILRADQVQSVILNSDRESGRLGWDTFVTSKPEESDR
TDVCYEIHSL
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|340785197|ref|NC_015856.1|:c104914-103832 Collimonas fungivorans Ter331 chromosome, complete genome
ATGCTTACCGCGCAGCGGAGATTCGAACCTAGTGTAATCCAGCGCTTGCTGGACAAGCCGCATCGGTTCC
AGTTTTTCCAGGCTGTGATGATGTTGGAGCTGTGGTTGAAACGCAACGGCATCCCCCATGAGGAAGCCGT
CAGCGATTTCCTGCGTTTCCAGAACACCGTGTCGCTGAATTTTCCTCCGAGCGAAATCGAAGCGCTGGAG
GTAACGCCCAAGCTGACCGAACAAACGGTGGAAGCGCTGCTGGACGCATTGCAGACCAACCAGCTCGACA
GCATTGCGCTGACGCCGGCGTTCATCGGTTTTTTAGGCAGCAACGGCACCTTGCCCAGCCACTACTCGGA
ACGTATCGCTGCGCACCAGCTGTATGAAAAAGATCACGGGCCGCGCGCTTTCCTGGATGTCTTCTCGAAC
CGCAGCGTAGCGCTTTTTTTCAAGGCCTGGCGCAAGTACCGGCTGGAATTCAAGTACCAGATCGACGGCA
CCGACAGTTTCCTGCCGCTGCTGATGTCGCTCGCCGGCCTCGGCCACCGCACTTTGCGCGATCGCATGTC
GGAAGACGGCGCCGGCGTGCTGGACGAGTCGATCGGACATTTCGCCGCCGCCATCCGCCATCGGCCACCG
TCGGCAGCGTACATGCAGCGGGTGTTGCGCGAATATTTTTCGGTGCCGATCACCATCGAGCAGTTTGTCG
GCCATTGGTATAACGTGCCGGTCGACCAGCAAACCGTGCTGGGTTCCACCAACGCCCTGCTAGGCAGCGT
GGCGATGGTGGGCGAGCGGGTATGGCAGCGCGACCTGCGCATGCGCCTGAAAATCGGCCCGCTGGCGAAG
AAGAAGTTCGAGAGCTTTTTGCCGGGCGGCGCCGCCGCCATCGGCTTGCAAAAAATACTGGCGATGTTTA
CCAGTGTCTTCCTGGAGTATGAAATACAGCTGATCTTGCGCGCAGACCAGGTACAAAGCGTCATCCTCAA
CTCCGACCGTGAAAGCGGACGGCTGGGTTGGGATACTTTTGTCACCAGCAAGCCGGAAGAAAGCGACCGC
ACCGATGTCTGTTACGAAATTCACTCACTTTGA