SecReT6
Protein ID: 340785267
SecReT6 ID455
T6SS typei4b
Gene symbol-
Locus tagCFU_0070
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]104878..106722 [-]
Productprotein ImpG/VasA
NoteTssF
UniProt IDG0A7Z8
KEGG IDcfu:CFU_0070
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-202, Aligned region: 4..613
Protein Sequence: 614 a.a.     [Download]
>gi|340785267|ref|YP_004750732.1| protein ImpG/VasA [Collimonas fungivorans Ter331]
MDELLPYYERELGFLRRYSREFSERYPKIASRLLMSGEVSEDPHIERMIQSFALINARTSKRLDDDYPEF
TEALFEVLYPHYLRPFPSCSIARMDYSVAAAQLTTAMPVPRGTELTTRQVKGVACKFKTTYEVTVAPVQL
SHAVFDPIIEPPDAVLLPPTASSRIGITFESTAEQAGFAELGIKSLRVFIDGEPSFCAALRDTLFMRTVR
AYVEVGKSGKWHAVNKIPVTPVGFEEDESLIDFPARSHPAYRLLTEYFSYPEKFNFFDVDVAEITKLLPP
GCKKFTLHLVLSGLRADSNTARMLGTLSTNNLLLGCTPVINLFKQRGDPIRLTHTSAYYPVVGDSRRAYA
YEVHSIDSVQLVRQTPEGESITEFRPFYSLRHGESVDKAGHYWAMRRDEMVASRSPGYETEISIVDIDFD
PATIETDTLSIELTCCNRNLPASLAYGLAGGDLFLEGGSLVNSIGFLRKPSEPCRFERGRGAHWRLISHL
ALNHLSLAKGGLEALQETLSLYDLPRSAISQRQIGSVVGIDHKAATAWLPGNPFASLVRGIEIRVTLDEE
GFVGSGIHVFANVLDRFLGLYVHANSFTQLVIASKRTGEEILRCLPRSGDSNLV
 
Nucleotide Sequence: 1845 bp     [Download]
>gi|340785197|ref|NC_015856.1|:c106722-104878 Collimonas fungivorans Ter331 chromosome, complete genome
GTGGACGAATTACTTCCCTATTACGAGCGCGAGCTCGGTTTCCTGAGACGCTATTCGCGCGAATTTTCCG
AACGCTATCCGAAGATTGCCAGCCGCCTGCTGATGTCCGGCGAAGTATCCGAAGATCCGCACATCGAGCG
CATGATCCAGTCGTTTGCGCTGATCAATGCCCGCACCTCGAAGCGGCTGGACGACGATTACCCGGAATTT
ACCGAAGCCCTGTTCGAAGTGCTGTATCCGCATTACCTGCGGCCGTTTCCCTCCTGCTCGATCGCACGCA
TGGACTACAGCGTCGCGGCGGCGCAGCTGACTACCGCCATGCCGGTGCCGCGCGGCACCGAACTGACCAC
GCGCCAGGTCAAGGGCGTGGCTTGCAAGTTCAAGACGACCTATGAAGTGACGGTGGCGCCGGTGCAGCTG
TCGCATGCGGTATTCGACCCCATCATCGAACCGCCGGACGCGGTGCTGCTGCCGCCTACCGCCAGCTCAC
GCATCGGCATCACTTTCGAGAGCACGGCGGAGCAAGCCGGTTTTGCCGAACTGGGCATCAAGAGCCTGCG
CGTATTCATCGACGGCGAACCGTCGTTCTGCGCGGCACTGCGCGACACCCTGTTCATGCGCACCGTGCGC
GCCTATGTCGAAGTCGGCAAGAGCGGCAAATGGCATGCCGTGAACAAGATCCCGGTCACCCCTGTCGGCT
TTGAAGAAGACGAATCGTTGATCGACTTCCCGGCCCGCTCGCATCCTGCCTACCGGCTGCTGACCGAGTA
CTTTTCCTATCCAGAGAAATTCAATTTCTTTGACGTCGATGTTGCCGAAATCACAAAGCTGCTGCCGCCC
GGCTGCAAGAAATTCACCTTGCACCTGGTGCTGTCCGGGCTGCGCGCCGACTCCAACACCGCGCGCATGC
TGGGCACCTTGTCGACCAACAACCTGCTGCTAGGCTGCACCCCGGTCATCAACCTGTTCAAGCAGCGCGG
CGACCCGATCCGGCTGACCCACACCAGCGCCTACTATCCGGTAGTAGGCGACTCGCGGCGCGCCTATGCG
TATGAAGTGCATTCCATCGATTCGGTGCAGCTGGTGCGGCAAACCCCGGAAGGTGAATCGATTACCGAAT
TCCGGCCTTTCTATTCCTTGCGTCACGGCGAAAGCGTGGACAAGGCAGGCCATTACTGGGCCATGCGGCG
CGACGAAATGGTTGCGTCGCGCAGTCCGGGCTATGAAACCGAAATTTCCATCGTCGACATCGACTTCGAT
CCGGCCACCATAGAAACCGATACGCTGAGCATCGAGCTGACCTGCTGCAATCGCAACCTGCCGGCTTCCC
TGGCTTACGGCCTGGCCGGCGGCGACCTGTTCTTGGAAGGCGGTTCGCTGGTGAACTCCATCGGCTTCTT
GCGCAAACCGTCCGAACCGTGCCGCTTCGAGCGCGGCCGCGGCGCGCACTGGCGCCTGATTTCCCATCTT
GCATTGAACCACCTGTCGCTGGCCAAGGGCGGCCTGGAGGCTTTGCAAGAAACCCTGAGCTTGTACGATT
TACCGCGTTCGGCGATTTCCCAGCGCCAGATCGGCAGCGTGGTCGGCATCGACCACAAGGCCGCCACCGC
CTGGCTGCCCGGCAATCCGTTTGCGTCGCTGGTGCGCGGCATCGAGATCAGGGTAACGCTGGACGAGGAA
GGTTTTGTGGGTAGCGGCATCCATGTGTTTGCCAATGTCCTGGACCGCTTCCTCGGCCTGTATGTGCATG
CCAACAGCTTTACGCAATTGGTGATAGCTTCCAAACGAACAGGTGAGGAGATACTGCGATGCTTACCGCG
CAGCGGAGATTCGAACCTAGTGTAA