SecReT6
Protein ID: 340785268
SecReT6 ID455
T6SS typei4b
Gene symbol-
Locus tagCFU_0071
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]106724..107215 [-]
Producthypothetical protein
NoteTssE
UniProt IDG0A7Z9
KEGG IDcfu:CFU_0071
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-18, Aligned region: 29..135
Protein Sequence: 163 a.a.     [Download]
>gi|340785268|ref|YP_004750733.1| hypothetical protein CFU_0071 [Collimonas fungivorans Ter331]
MKGFTPGLFDRLMGGDNTPAQSDLVVRLSMDALKDTVARDLEAMLNTRTVIPEELLKNFPECSKSILTYG
LNDFSGMSLASLDDRAHICQCLEQGIARHEPRLRNVRASLELREGSINRLNFAIAAMLVVGPAKEAVSFD
AVLQPSTLQYSISRARRAMRMDG
 
Nucleotide Sequence: 492 bp     [Download]
>gi|340785197|ref|NC_015856.1|:c107215-106724 Collimonas fungivorans Ter331 chromosome, complete genome
ATGAAAGGTTTCACTCCAGGATTGTTTGACCGGTTGATGGGCGGCGACAACACGCCTGCGCAATCCGATC
TGGTAGTGCGATTGTCGATGGATGCCTTGAAAGACACGGTCGCCCGCGACCTTGAGGCCATGCTCAATAC
GCGCACCGTGATTCCCGAAGAATTGCTGAAGAATTTCCCCGAATGCAGCAAGTCGATACTGACCTACGGC
TTGAACGATTTTTCCGGCATGAGCCTGGCCAGCCTGGATGACCGGGCGCATATCTGCCAGTGCCTGGAAC
AGGGCATTGCGCGCCACGAGCCGCGCCTGAGGAACGTGCGCGCCTCGCTCGAGCTGCGCGAAGGATCGAT
CAACCGCTTGAATTTTGCGATTGCAGCCATGCTGGTGGTGGGGCCGGCCAAGGAAGCCGTGAGCTTCGAC
GCCGTGCTGCAGCCGTCGACCTTGCAATATTCAATCAGCAGAGCACGCCGCGCGATGCGGATGGACGGTT
AA