SecReT6
Protein ID: 340785269
SecReT6 ID455
T6SS typei4b
Gene symbol-
Locus tagCFU_0072
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]107278..107769 [-]
Productputative cytoplasmic protein USSDB7A
NoteTssD
UniProt IDG0A800
KEGG IDcfu:CFU_0072
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.50E-44, Aligned region: 6..139
Protein Sequence: 163 a.a.     [Download]
>gi|340785269|ref|YP_004750734.1| putative cytoplasmic protein USSDB7A [Collimonas fungivorans Ter331]
MAIDVYLQIDGIKGESTDSAHKDWIECKSVQWEVLQPKSATASTGGGHTAERCEHKDIVVTKIADLATPL
LLQNCSSGKTIPKAKFEFLRADGKGDRIKYFEIELVNLLISDVTPSVQEGDVLSESISLKYSQVKWKYTQ
QKIGGGSGGNTSGGWDLSTNKVV
 
Nucleotide Sequence: 492 bp     [Download]
>gi|340785197|ref|NC_015856.1|:c107769-107278 Collimonas fungivorans Ter331 chromosome, complete genome
ATGGCAATTGACGTTTATCTGCAAATCGACGGCATCAAGGGCGAGTCGACCGACAGTGCGCACAAGGACT
GGATCGAGTGCAAATCGGTGCAATGGGAAGTGCTGCAGCCAAAGTCGGCGACTGCATCCACCGGCGGCGG
CCACACAGCCGAGCGTTGCGAACACAAGGACATCGTCGTGACCAAGATCGCCGATCTGGCTACGCCGCTG
CTGCTGCAGAACTGCTCATCGGGTAAGACCATCCCGAAAGCCAAGTTCGAATTCCTGCGCGCCGACGGCA
AGGGCGACCGCATCAAGTATTTCGAAATCGAGCTGGTCAACCTGCTGATTTCCGACGTCACGCCATCGGT
CCAGGAAGGCGACGTGCTGAGCGAAAGCATCAGCCTGAAGTACTCCCAGGTCAAATGGAAGTACACACAG
CAAAAAATCGGCGGCGGTTCGGGCGGCAATACTTCCGGCGGCTGGGATCTGTCGACCAACAAGGTCGTGT
AA