SecReT6
Protein ID: 340785270
SecReT6 ID455
T6SS typei4b
Gene symbolimpC
Locus tagCFU_0073
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]107793..109280 [-]
Producthypothetical protein
NoteTssC
UniProt IDG0A801
KEGG IDcfu:CFU_0073
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.80E-189, Aligned region: 66..490
Protein Sequence: 495 a.a.     [Download]
>gi|340785270|ref|YP_004750735.1| hypothetical protein CFU_0073 [Collimonas fungivorans Ter331]
MSFQHNSAPAAGAAAEESGLLDQIVEQSKVAKSGAEHDRAKDIISELVNQVMQGTVVVSANLSATIDARV
AELDRLISAQVSAVIHAPEFQKLESSWTGLHYLVFNSTTSQNLKIKVLNATKRELVKDFQSALEFDQSAI
FKKVYEEEFGTFGGAPFGSLLGDFEITRQPEDMYFVEQMSHIAAAAHAPFISSASPELFGLETYSELGKP
RDLAKVFETVEYAKWKSFRESEDSRYVGLTLPRFLGRLPFNPKDGQTVEGFNFVEDVDGTDHSKYLWCNA
AYAFGTKLTKAFEDFGWCAAIRGVEGGGLVEDLPTHTFKTDEGEVALKCPTEIAITDRREKELSDLGFIS
LVHCKNTDYAAFFGAQSTQKAKKYNTDSANANSVLSAQLQYIFAVSRIAHYMKSMMRDKIGSFASAGNVE
DFLNRWLTQYVLLDDNASQEAKAQFPLREASVQVSEVPGRPGVYRAVSFLRPHFQLDELSVSLRLVAELP
ASTKS
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|340785197|ref|NC_015856.1|:c109280-107793 Collimonas fungivorans Ter331 chromosome, complete genome
ATGTCCTTTCAGCATAATTCTGCGCCAGCCGCAGGGGCGGCCGCAGAAGAATCCGGTTTGCTCGACCAGA
TCGTAGAACAGAGCAAAGTCGCCAAGTCCGGCGCCGAGCACGACCGCGCCAAAGACATCATTTCGGAACT
GGTGAACCAGGTCATGCAAGGCACCGTGGTGGTGTCGGCCAACCTGTCGGCCACCATCGACGCCCGCGTG
GCCGAGCTGGACCGCCTGATTTCCGCCCAGGTCAGCGCCGTGATCCATGCGCCTGAATTCCAGAAACTGG
AAAGCAGCTGGACCGGCCTGCACTACCTGGTGTTCAACTCGACCACCAGCCAGAACCTCAAGATCAAGGT
CTTGAACGCCACCAAGCGGGAATTGGTCAAGGACTTCCAGAGCGCCCTCGAGTTCGACCAGAGCGCAATC
TTCAAGAAAGTCTATGAAGAAGAGTTCGGCACTTTCGGCGGTGCGCCGTTCGGCTCCCTGCTGGGCGATT
TCGAAATCACCCGGCAGCCGGAAGACATGTATTTCGTCGAACAGATGTCGCATATCGCAGCGGCTGCCCA
TGCACCGTTCATCAGCTCGGCCTCGCCTGAGCTGTTCGGCCTGGAAACCTACAGCGAACTCGGCAAGCCG
CGCGACTTGGCCAAGGTGTTCGAGACCGTCGAATACGCCAAATGGAAGTCTTTCCGCGAATCCGAAGATT
CACGTTATGTCGGCCTGACCCTGCCGCGCTTCCTGGGCCGCCTGCCGTTCAATCCGAAGGATGGCCAGAC
AGTCGAAGGCTTCAACTTTGTCGAAGATGTCGACGGCACCGATCACTCCAAGTACCTCTGGTGTAACGCA
GCGTATGCCTTCGGCACCAAGCTGACCAAGGCATTTGAAGATTTCGGCTGGTGCGCGGCGATCCGCGGCG
TCGAAGGCGGCGGCCTGGTGGAAGACTTGCCGACCCACACCTTCAAGACCGACGAAGGCGAAGTCGCGCT
CAAGTGCCCGACCGAAATCGCGATTACCGACCGCCGCGAAAAAGAACTGAGCGACCTCGGCTTCATCTCG
CTGGTGCATTGCAAGAACACCGATTACGCCGCCTTCTTCGGCGCGCAGTCGACGCAAAAAGCCAAGAAAT
ACAATACCGATTCGGCCAACGCCAATTCTGTGCTGTCAGCCCAGCTGCAGTACATTTTTGCCGTATCGCG
TATTGCGCATTACATGAAATCGATGATGCGCGACAAGATCGGCAGCTTTGCTTCGGCAGGCAACGTGGAG
GATTTTCTCAACCGTTGGCTGACCCAGTATGTGCTGCTTGATGACAATGCCAGCCAAGAAGCCAAAGCGC
AATTTCCCTTGCGCGAAGCCTCGGTGCAGGTATCCGAAGTACCGGGACGTCCGGGCGTCTACCGTGCAGT
GTCCTTCCTGCGCCCGCACTTCCAGCTTGACGAACTTTCAGTTTCACTGCGCTTGGTTGCAGAATTACCA
GCGTCAACCAAGTCTTAA