SecReT6
Protein ID: 340785271
SecReT6 ID455
T6SS typei4b
Gene symbolimpB
Locus tagCFU_0074
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]109282..109791 [-]
Producthypothetical protein
NoteTssB
UniProt IDG0A802
KEGG IDcfu:CFU_0074
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-60, Aligned region: 11..166
Protein Sequence: 169 a.a.     [Download]
>gi|340785271|ref|YP_004750736.1| hypothetical protein CFU_0074 [Collimonas fungivorans Ter331]
MAKKESTQKRLQKVRPPRVQMTYDVEIGDAIEQKELPFVMGVIGDFSGKSEVAQTKLKDRKFVNIDNDNF
DEVMKGVEPRAAFRVPNHLSDAGGEFGVDLKFKSIDDFRPEAVVQQIEPLKQLLEARTKLADLRNKLAGN
DKLEDILNDVLNSTEKLAALSKQTKKQGD
 
Nucleotide Sequence: 510 bp     [Download]
>gi|340785197|ref|NC_015856.1|:c109791-109282 Collimonas fungivorans Ter331 chromosome, complete genome
ATGGCTAAAAAAGAGAGTACTCAAAAACGTTTGCAGAAAGTCCGTCCACCACGGGTGCAAATGACATACG
ACGTTGAAATCGGCGACGCCATCGAGCAAAAGGAATTGCCGTTCGTGATGGGCGTGATCGGCGATTTCAG
CGGCAAGTCCGAAGTGGCCCAGACCAAGCTGAAGGACCGCAAGTTCGTCAATATCGACAACGACAACTTC
GATGAAGTGATGAAGGGCGTCGAGCCGAGAGCTGCGTTCCGCGTGCCGAATCATTTGAGCGACGCCGGCG
GCGAGTTCGGGGTCGACTTGAAGTTCAAGTCGATCGACGATTTCCGCCCGGAAGCGGTAGTCCAGCAGAT
CGAGCCGCTCAAGCAGCTGCTCGAAGCCCGCACCAAACTGGCCGACCTGCGCAACAAGCTGGCCGGCAAC
GACAAGCTGGAAGATATCCTCAACGATGTGCTCAACAGCACCGAAAAGCTGGCGGCGTTAAGCAAGCAAA
CCAAGAAGCAAGGAGACTGA