SecReT6
Protein ID: 340785273
SecReT6 ID455
T6SS typei4b
Gene symbol-
Locus tagCFU_0076
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]110715..111314 [+]
Productputative transmembrane protein
NoteTssJ
UniProt IDG0A804
KEGG IDcfu:CFU_0076
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.90E-35, Aligned region: 14..173
Protein Sequence: 199 a.a.     [Download]
>gi|340785273|ref|YP_004750738.1| putative transmembrane protein [Collimonas fungivorans Ter331]
MRPLSLLVSLAAILSLAGCAAGAVSAIGSVASSVLQMSGITKPEVPDAQKPPRTIAIKLHAGSNLNADSS
GTPLALVARVYKLRQNGAFQQATYDTFTNPQKEKDVLGADLIEVKEITLVPGQRYEVSEKVTREAGFVGI
VALFRKPAAQRWKVTFPTEAAEKSGITVGANACALTVGTGVTVAETGAATKLLTPAPCG
 
Nucleotide Sequence: 600 bp     [Download]
>gi|340785197|ref|NC_015856.1|:110715-111314 Collimonas fungivorans Ter331 chromosome, complete genome
ATGCGCCCCTTATCTCTCCTGGTTTCGCTGGCCGCAATACTGAGTTTGGCTGGTTGCGCCGCAGGCGCCG
TTTCCGCGATCGGCTCTGTCGCCAGTTCTGTATTGCAGATGTCAGGCATCACCAAGCCAGAGGTTCCCGA
TGCTCAAAAACCGCCGCGCACCATAGCGATCAAGCTGCATGCAGGCAGCAATTTGAACGCCGACAGCTCC
GGTACGCCGCTTGCCCTGGTCGCCAGAGTATATAAGTTACGACAAAATGGTGCTTTCCAACAGGCTACAT
ACGATACATTTACCAATCCGCAGAAAGAAAAAGACGTATTGGGCGCCGATTTGATCGAAGTCAAGGAAAT
TACACTGGTTCCTGGACAACGTTATGAAGTCAGCGAAAAAGTCACCAGGGAAGCGGGTTTTGTCGGGATT
GTGGCCTTGTTCCGCAAGCCCGCGGCACAACGCTGGAAGGTGACTTTCCCGACCGAGGCTGCGGAAAAAT
CAGGCATTACCGTTGGCGCCAACGCCTGTGCGCTGACAGTCGGCACCGGCGTCACGGTTGCGGAAACCGG
CGCTGCGACTAAACTTTTAACCCCGGCCCCATGCGGCTAG