SecReT6
Protein ID: 340785274
SecReT6 ID455
T6SS typei4b
Gene symbol-
Locus tagCFU_0077
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]111370..112728 [+]
Producthypothetical protein
NoteTssK
UniProt IDG0A805
KEGG IDcfu:CFU_0077
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.40E-127, Aligned region: 23..450
Protein Sequence: 452 a.a.     [Download]
>gi|340785274|ref|YP_004750739.1| hypothetical protein CFU_0077 [Collimonas fungivorans Ter331]
MSKYVNRTSKILWGEGLFLRPQHFQQQDRYHENRLHETTNALHPYAWGVMTVQLDRDALANNTLRLSELS
VIFQDGEIYNAPGDDDLPEVVDLSDIPHAQQTITYYAALPYMKGFGGNFSPLGQTSNSTRYAQNNSATPD
LFTQAAEAELTYLKKSVRMVSEVEPRDSLISFPLIKLRRISTGGFEPDPTFVAPSLTIRSAPALYIQLRR
LMDALQAKVNALYGHHREPSKNVIEFRSGDISSFWLLHTASSAFAGLTHYFHNPAFHPERLYEQLLSLAG
ALMTFSKSYALSDLPVYQHQDPGPCFAKLDSIIRELLDTVISSRYFSIALSENKPSHHHGMLDSGKIDDK
TAFYLAVNASMPAIELVDIVPLRFKIGAPDDVDKFVLSAMPGVKLSHSPQVPAALPVRPDTYYFALENKG
ALYDRMLQAQSISIYVPSGINDLKLELLAVTS
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|340785197|ref|NC_015856.1|:111370-112728 Collimonas fungivorans Ter331 chromosome, complete genome
GTGAGTAAATACGTGAATCGAACATCGAAAATTTTATGGGGCGAGGGCCTGTTTCTACGGCCCCAGCATT
TCCAGCAGCAGGACCGGTATCACGAAAACCGCCTGCACGAAACCACCAACGCCTTGCATCCATATGCCTG
GGGCGTGATGACGGTGCAGCTGGACCGCGATGCGCTGGCCAACAACACGCTGCGTTTATCCGAGCTGTCG
GTGATTTTCCAGGACGGCGAGATTTACAACGCGCCTGGCGACGACGACCTGCCGGAAGTGGTCGACCTGA
GCGATATCCCGCATGCGCAGCAAACCATTACTTATTACGCGGCGCTGCCGTACATGAAAGGCTTCGGCGG
CAATTTCTCGCCGCTAGGCCAGACCAGCAACTCGACCCGTTACGCCCAGAACAATTCGGCCACGCCGGAC
CTGTTCACGCAAGCGGCGGAAGCCGAGCTGACCTATCTGAAAAAATCGGTGCGCATGGTGTCCGAAGTCG
AGCCGCGCGATTCGCTGATCAGCTTCCCGCTGATCAAGCTGCGCCGCATTTCCACCGGCGGCTTCGAGCC
GGATCCGACCTTCGTCGCGCCCAGCCTGACGATCCGCAGCGCACCGGCGCTGTATATCCAGCTGCGGCGC
CTGATGGATGCGCTGCAGGCCAAGGTCAACGCCTTGTACGGCCATCATCGCGAGCCGAGCAAGAACGTCA
TCGAATTCCGTTCCGGCGATATTTCATCGTTCTGGCTGCTGCACACTGCTAGCTCGGCGTTCGCCGGACT
GACGCATTATTTCCACAACCCGGCCTTCCATCCGGAGCGTTTGTACGAGCAGCTGCTGAGCCTGGCCGGC
GCGCTGATGACGTTTTCCAAGAGTTATGCGCTGTCGGACCTGCCGGTGTACCAGCACCAGGATCCGGGGC
CGTGTTTCGCCAAGCTCGACAGCATCATCCGCGAGCTGCTGGACACCGTGATTTCCTCGCGCTACTTCTC
GATCGCGCTGTCGGAGAACAAGCCTTCGCACCACCACGGCATGCTCGACTCCGGCAAGATCGACGACAAG
ACCGCCTTCTACCTGGCGGTCAACGCCAGCATGCCGGCCATCGAACTGGTCGATATCGTGCCGCTGCGCT
TCAAGATCGGCGCGCCGGACGACGTCGACAAGTTCGTGCTGTCGGCGATGCCGGGGGTCAAGCTGTCGCA
TTCGCCGCAAGTGCCGGCAGCCTTGCCGGTGCGGCCGGACACTTATTATTTTGCCTTGGAAAACAAGGGC
GCCCTGTATGATCGTATGCTGCAGGCGCAGTCGATCTCGATTTATGTACCATCCGGCATCAACGACCTTA
AACTTGAGCTCTTAGCGGTTACATCATGA