SecReT6
Protein ID: 340785275
SecReT6 ID455
T6SS typei4b
Gene symbol-
Locus tagCFU_0078
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]112725..113501 [+]
Productputative transmembrane protein
NoteTssL
UniProt IDG0A806
KEGG IDcfu:CFU_0078
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.10E-55, Aligned region: 27..229
Protein Sequence: 258 a.a.     [Download]
>gi|340785275|ref|YP_004750740.1| putative transmembrane protein [Collimonas fungivorans Ter331]
MNRPSAPSLLGDSAGGQYVAADTSSANSLLDLMYDGFYALFLLKNRCAPTDEAGFTSKMQRFLSDFERGA
KKLDVSAEDVHAAKYAFCAAVDENILHSQFNIRDTWARRPLQLILFGDQLAGEHFFTRLEDLRAKGAQHL
QALEVFHMCLLLGFQGKYIIEGPEKLNYLTARLGDEIARMKGKSAGFAPHWERPDQISHKLRNEVPLWAL
CSVFALIGLGGYFALNTMLSRATASSISGYSDIVKLAPRASYLTITLP
 
Nucleotide Sequence: 777 bp     [Download]
>gi|340785197|ref|NC_015856.1|:112725-113501 Collimonas fungivorans Ter331 chromosome, complete genome
ATGAACAGACCATCAGCCCCATCCCTGCTCGGCGACAGCGCCGGCGGCCAATACGTAGCGGCGGACACCA
GCTCGGCCAATTCATTGCTGGACCTGATGTACGACGGGTTCTACGCCTTGTTCCTGCTGAAAAACCGCTG
TGCGCCTACCGACGAAGCCGGTTTCACGTCGAAGATGCAGCGCTTCCTCAGCGATTTCGAACGCGGCGCA
AAAAAGCTGGATGTGTCGGCCGAAGACGTCCACGCTGCGAAGTACGCATTTTGCGCGGCGGTCGACGAGA
ACATCCTGCATTCGCAATTCAATATCCGCGATACCTGGGCGCGCCGGCCGCTGCAATTGATCCTGTTCGG
CGACCAGCTCGCCGGTGAACATTTCTTCACCCGCCTGGAAGACCTGCGCGCCAAGGGCGCCCAGCACCTG
CAGGCGCTGGAAGTGTTCCACATGTGCCTGCTGCTGGGCTTCCAGGGCAAGTACATTATCGAAGGCCCGG
AAAAACTGAACTACCTGACGGCCCGCCTGGGCGATGAAATCGCACGCATGAAAGGCAAGAGCGCCGGCTT
CGCGCCGCACTGGGAGCGGCCGGATCAGATCAGCCACAAGCTGCGCAACGAAGTGCCGCTGTGGGCGCTG
TGTTCGGTATTCGCCCTGATCGGACTGGGCGGCTATTTTGCACTGAACACCATGCTATCGCGCGCCACCG
CATCGAGCATCAGCGGTTACAGCGACATCGTCAAACTGGCGCCGCGTGCGTCCTATCTGACCATTACCCT
GCCTTGA