SecReT6
Protein ID: 340785276
SecReT6 ID455
T6SS typei4b
Gene symbol-
Locus tagCFU_0079
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]113553..116204 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG0A807
KEGG IDcfu:CFU_0079
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.20E-60, Aligned region: 48..359
DUF2345 [PF10106], Evalue: 4.00E-48, Aligned region: 647..798
T6SS_Vgr [PF13296], Evalue: 1.60E-33, Aligned region: 513..619
T6SS_Vgr [PF13296], Evalue: 1.60E-33, Aligned region: 679..699
Phage_base_V [PF04717], Evalue: 7.60E-23, Aligned region: 398..491
Protein Sequence: 883 a.a.     [Download]
>gi|340785276|ref|YP_004750741.1| Rhs element Vgr protein [Collimonas fungivorans Ter331]
MGHGMSNILQSLQSLISGRQTNRILRLSFPHDDGPSAQLLVNKLDAVESLSRDFEFTVELLSDDASLALK
DLQGKLFNVELVRADGSLRYFSGYCFEFRLVKTDGSISFYQAKLGPWLHYLRLRQDNYIFHGKTLREQTE
SIFSDYGTHPDWDVRVRGEDVAMTDACQFNESDFNYLHRRWEAAGWSYWYEHTDKGHKLILTDDTTQAAA
IDNGPEIRFQRHGGAIEEDGIGDWSPVRQIVPGSVSLAGFNFKSPVPSNVGVPTLNKQGDVLNIESYEYT
GTYGYKGSQDGDKQAQLRMEEIEAAGKHFEAKGNNRSVLPGRYFRLSNHFAFNPFGSHEEAGKSEFLILT
VHHKATNNYLQQASDKADYSNALTCIRKTIPWRPGRGFNSTATRIQAPQTATVVGPSGQDSIYTDEYGRI
RVQFHWDRIGNNDEKSSAWIRVASGWAGSELGAAAIPRVGSEVIVQWLDGNPDRPLITGSVYNQRNMPPW
KLATQQSLMGLRSRELTPNGGNQAGGRSNHLILDDTNAKIQAQLKSDHQHSQLSLGNITRIEDNAGRKDA
RGEGWELRTDGHGVARSAKGMLITTEGRSNAASHMKDMGETVQRLTSARDQHETLAEMAQQAGAQEKQGQ
QADVAQILKTQNEAIKGGTAKEGSFPELAQPHLVLASPAGIETTTAQSTHIASDEHTAITTGKSLSIASG
DSLFASITNTFRLFVQKTGMKMVAAAGDVDMQTLSDSINLLAKLNITQTANTITITAKEEVVINGGGSYG
KFNAGGIEHGTNGNYVAHAATHSLPGAKNLAIKMPEFPHVAMPGVFNEYFHIAEEGTGKKLANIPYTLAR
HSTGETIEGVTATNGKTQLAGTEKKSDDLHFFYTGDKKENHGW
 
Nucleotide Sequence: 2652 bp     [Download]
>gi|340785197|ref|NC_015856.1|:113553-116204 Collimonas fungivorans Ter331 chromosome, complete genome
ATGGGACACGGCATGAGCAACATACTTCAGAGCCTGCAAAGCCTCATTAGCGGGCGCCAGACCAACCGTA
TCCTGCGCCTGTCCTTTCCCCACGATGATGGCCCATCTGCGCAGCTGCTGGTCAACAAGCTCGATGCGGT
GGAAAGCCTGTCGCGTGATTTTGAATTTACCGTAGAGCTGCTGTCCGATGATGCCAGCCTGGCGCTCAAG
GATTTGCAAGGCAAGCTGTTTAACGTAGAACTGGTGCGCGCCGACGGCAGCCTGCGCTACTTCAGCGGCT
ACTGCTTTGAATTCCGCCTGGTGAAGACCGACGGCAGCATCAGTTTTTATCAGGCCAAACTCGGCCCCTG
GTTGCACTACCTGCGCCTGCGCCAGGACAACTACATCTTCCACGGCAAGACCCTGCGCGAGCAGACCGAG
AGCATCTTCAGCGATTACGGCACCCATCCCGACTGGGATGTGCGGGTGCGCGGCGAAGATGTGGCAATGA
CCGACGCCTGCCAGTTCAACGAGAGCGATTTCAATTACCTGCACCGGCGCTGGGAAGCGGCCGGCTGGTC
GTACTGGTATGAACATACTGACAAGGGTCACAAGCTGATCCTGACCGACGACACCACCCAGGCAGCAGCG
ATCGACAACGGCCCCGAGATCCGCTTCCAGCGCCATGGCGGTGCGATTGAGGAAGACGGCATCGGCGACT
GGTCGCCGGTGCGCCAGATCGTGCCCGGCAGCGTCAGCCTGGCAGGGTTTAATTTTAAAAGTCCGGTGCC
CAGTAACGTCGGTGTGCCGACCCTGAACAAGCAGGGCGATGTCCTCAATATCGAATCCTACGAATACACC
GGCACCTATGGCTATAAAGGTAGCCAGGATGGCGACAAGCAGGCGCAGCTGCGCATGGAAGAGATCGAGG
CAGCCGGTAAACACTTTGAAGCCAAAGGCAATAACCGCTCGGTACTGCCGGGACGGTATTTCCGTTTAAG
CAATCATTTTGCCTTCAATCCCTTCGGCAGCCATGAAGAAGCCGGTAAAAGCGAATTCCTGATCCTCACC
GTCCACCACAAGGCGACCAACAATTATCTGCAGCAGGCCAGCGACAAGGCCGATTACAGCAACGCATTAA
CCTGCATCCGTAAAACCATCCCCTGGCGTCCAGGCCGCGGTTTTAACAGCACTGCCACCAGGATCCAGGC
GCCACAGACCGCGACCGTGGTCGGACCTTCCGGCCAGGACAGCATCTATACCGATGAATACGGCCGTATC
CGTGTCCAGTTCCACTGGGACCGGATCGGCAACAACGATGAAAAGAGCTCGGCCTGGATCCGTGTTGCCT
CCGGCTGGGCCGGCAGCGAACTGGGAGCGGCGGCGATTCCCCGGGTCGGCAGCGAAGTGATCGTGCAATG
GCTCGATGGCAACCCTGACCGGCCCCTGATTACCGGCAGCGTCTATAACCAGCGCAACATGCCGCCCTGG
AAGCTGGCGACCCAGCAATCGTTGATGGGCCTCAGAAGCCGTGAGCTGACCCCGAATGGCGGCAACCAGG
CAGGGGGTCGCAGCAACCACCTGATCCTGGACGACACCAACGCCAAGATCCAGGCCCAATTAAAGAGCGA
TCACCAGCACAGCCAGCTCAGCCTGGGCAACATCACCCGCATTGAAGACAATGCCGGCCGCAAGGATGCA
CGCGGCGAAGGCTGGGAACTGAGAACCGATGGTCATGGCGTGGCCCGTTCAGCGAAAGGCATGCTGATCA
CCACTGAAGGGCGCAGCAATGCGGCTTCGCACATGAAGGATATGGGCGAGACGGTGCAAAGGCTTACCTC
TGCGCGCGACCAGCACGAGACGCTGGCGGAGATGGCGCAGCAGGCGGGGGCGCAGGAGAAGCAGGGTCAG
CAGGCCGATGTTGCGCAGATTCTCAAGACGCAGAATGAGGCAATCAAGGGTGGCACAGCAAAAGAGGGCA
GTTTCCCGGAACTGGCCCAACCGCATCTGGTGCTGGCCAGTCCCGCCGGCATAGAAACCACCACCGCGCA
ATCGACGCACATTGCCAGCGATGAGCACACCGCCATCACTACCGGCAAGAGTCTGTCCATTGCCAGTGGC
GATAGCCTGTTTGCCAGTATTACGAATACTTTCCGCTTGTTTGTACAAAAAACGGGAATGAAAATGGTCG
CAGCTGCCGGCGATGTGGATATGCAGACTCTCTCAGACAGCATCAACCTGCTGGCCAAGTTGAACATCAC
GCAAACTGCAAACACCATTACCATTACCGCCAAAGAAGAGGTAGTGATCAATGGCGGAGGCAGTTACGGG
AAATTCAATGCCGGCGGCATCGAGCACGGTACTAACGGCAATTATGTCGCCCATGCAGCTACGCACAGCT
TGCCAGGAGCGAAAAATCTGGCCATCAAAATGCCTGAGTTCCCTCACGTAGCTATGCCTGGCGTGTTCAA
TGAATATTTTCATATCGCTGAAGAAGGCACGGGAAAAAAATTGGCCAACATACCGTACACTCTCGCACGT
CATTCAACAGGTGAGACGATAGAAGGAGTAACCGCCACAAATGGCAAGACACAATTAGCTGGCACTGAAA
AAAAATCCGACGATCTGCATTTCTTCTATACAGGTGATAAAAAGGAAAATCATGGCTGGTGA