SecReT6
Protein ID: 34499418
SecReT6 ID49
T6SS typei4b
Gene symbol-
Locus tagCV_3963
StrainChromobacterium violaceum ATCC 12472
Repliconchromosome [GenBank: NC_005085] [Browse all T6SS(s) in this replicon]
Location [Strand]4283686..4284771 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ7NR22
KEGG IDcvi:CV_3963
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.70E-22, Aligned region: 56..116
Protein Sequence: 361 a.a.     [Download]
>gi|34499418|ref|NP_903633.1| hypothetical protein CV_3963 [Chromobacterium violaceum ATCC 12472]
MDQSIEHLMQPVRPDAPAGEDLAYSLIFDQIREARRSDDPSLAMGDWEQSLKTAEWPQVIRLCEDALKNK
SKDLQLLAWYAEAQTQVNGAGGLARGLALVGGWLRDFWESGYPELDPHDLDERVAKLEWMNQQLGNALRN
VPLIKPEFGGYSWHQWQQSRDVENLGLKDGEAREAAIAEGKLSGEAFEKAATLSGHGWFQAKAEELVALL
TAYEELDALVDQRFGQAGPSLADIRNAIYACQDLVLRYRQQFAGNAPAAAPQRQPVEESKPVSPAMSSPV
HAAAPATAFNGQIRSRQEAVTALTEVARYFRHNEPHSPVALLAERAARWAEMSLEEWLQHVVKDSGTLSQ
LQELLDVRQGD
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|34495455|ref|NC_005085.1|:c4284771-4283686 Chromobacterium violaceum ATCC 12472 chromosome, complete genome
ATGGATCAAAGCATTGAACATCTGATGCAGCCGGTGCGTCCGGATGCGCCGGCCGGGGAAGACCTGGCCT
ACTCCCTGATCTTCGACCAGATCCGCGAGGCGCGCCGCAGCGACGATCCGTCGCTGGCGATGGGCGATTG
GGAACAGTCGCTGAAGACCGCCGAATGGCCGCAAGTGATACGCCTGTGCGAAGACGCGCTGAAGAACAAG
AGCAAGGATCTGCAGCTGCTGGCCTGGTATGCCGAGGCGCAGACCCAGGTCAACGGCGCGGGCGGCCTGG
CGCGCGGCCTGGCGCTGGTGGGCGGCTGGCTGCGGGACTTCTGGGAAAGCGGCTATCCCGAACTGGACCC
GCACGATCTGGACGAGCGCGTGGCCAAGCTGGAGTGGATGAACCAGCAGCTGGGCAACGCGCTACGCAAT
GTGCCGCTGATCAAGCCCGAGTTCGGCGGCTACAGCTGGCACCAGTGGCAGCAGTCGCGCGATGTGGAGA
ACCTGGGCCTGAAGGACGGCGAGGCGCGCGAGGCCGCCATCGCCGAGGGCAAGCTCAGCGGCGAGGCCTT
CGAAAAGGCCGCCACCCTGTCCGGCCACGGCTGGTTCCAGGCCAAGGCCGAAGAGCTGGTGGCCTTGCTG
ACCGCCTACGAGGAGCTGGATGCCTTGGTCGACCAGCGCTTCGGCCAGGCCGGCCCCAGCCTGGCCGACA
TCCGCAACGCCATCTACGCCTGCCAGGACCTGGTCCTGCGCTATCGCCAGCAATTCGCCGGCAACGCGCC
GGCGGCCGCGCCGCAGCGGCAGCCCGTCGAGGAAAGCAAACCTGTGAGCCCAGCCATGAGCAGTCCGGTC
CATGCCGCCGCCCCGGCTACCGCCTTCAACGGCCAGATCCGCAGCCGCCAGGAGGCGGTGACCGCCTTGA
CCGAGGTGGCCCGCTACTTCCGCCACAACGAGCCGCACAGCCCGGTGGCGCTGCTGGCCGAGCGCGCCGC
GCGCTGGGCGGAGATGAGCCTGGAGGAATGGCTGCAGCACGTGGTGAAGGACAGCGGCACGCTGAGCCAG
CTGCAGGAGCTGCTGGACGTGCGCCAGGGCGATTGA