SecReT6
Protein ID: 34499420
SecReT6 ID49
T6SS typei4b
Gene symbol-
Locus tagCV_3965
StrainChromobacterium violaceum ATCC 12472
Repliconchromosome [GenBank: NC_005085] [Browse all T6SS(s) in this replicon]
Location [Strand]4286490..4289117 [-]
ProductClpA/B-type chaperone
NoteTssH
UniProt IDQ7NR20
KEGG IDcvi:CV_3965
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.20E-43, Aligned region: 227..247
AAA_2 [PF07724], Evalue: 6.20E-43, Aligned region: 434..448
AAA_2 [PF07724], Evalue: 6.20E-43, Aligned region: 601..774
AAA [PF00004], Evalue: 2.30E-21, Aligned region: 227..339
AAA [PF00004], Evalue: 2.30E-21, Aligned region: 437..460
AAA [PF00004], Evalue: 2.30E-21, Aligned region: 490..501
AAA [PF00004], Evalue: 2.30E-21, Aligned region: 607..691
AAA_5 [PF07728], Evalue: 3.50E-16, Aligned region: 227..247
AAA_5 [PF07728], Evalue: 3.50E-16, Aligned region: 322..357
AAA_5 [PF07728], Evalue: 3.50E-16, Aligned region: 606..724
ClpB_D2-small [PF10431], Evalue: 7.70E-12, Aligned region: 563..586
ClpB_D2-small [PF10431], Evalue: 7.70E-12, Aligned region: 781..854
AAA_16 [PF13191], Evalue: 5.70E-11, Aligned region: 41..55
AAA_16 [PF13191], Evalue: 5.70E-11, Aligned region: 204..247
AAA_16 [PF13191], Evalue: 5.70E-11, Aligned region: 271..306
AAA_16 [PF13191], Evalue: 5.70E-11, Aligned region: 437..504
AAA_16 [PF13191], Evalue: 5.70E-11, Aligned region: 576..645
AAA_16 [PF13191], Evalue: 5.70E-11, Aligned region: 671..695
AAA_16 [PF13191], Evalue: 5.70E-11, Aligned region: 774..812
AAA_22 [PF13401], Evalue: 1.60E-10, Aligned region: 226..321
AAA_22 [PF13401], Evalue: 1.60E-10, Aligned region: 431..448
AAA_22 [PF13401], Evalue: 1.60E-10, Aligned region: 603..629
AAA_22 [PF13401], Evalue: 1.60E-10, Aligned region: 668..700
Clp_N [PF02861], Evalue: 1.80E-10, Aligned region: 19..70
Clp_N [PF02861], Evalue: 1.80E-10, Aligned region: 101..127
AAA_17 [PF13207], Evalue: 1.30E-07, Aligned region: 227..291
AAA_17 [PF13207], Evalue: 1.30E-07, Aligned region: 484..485
AAA_17 [PF13207], Evalue: 1.30E-07, Aligned region: 605..644
AAA_19 [PF13245], Evalue: 1.60E-07, Aligned region: 227..247
AAA_19 [PF13245], Evalue: 1.60E-07, Aligned region: 602..628
IstB_IS21 [PF01695], Evalue: 1.90E-06, Aligned region: 213..248
IstB_IS21 [PF01695], Evalue: 1.90E-06, Aligned region: 563..626
Zeta_toxin [PF06414], Evalue: 4.10E-06, Aligned region: 227..246
Zeta_toxin [PF06414], Evalue: 4.10E-06, Aligned region: 308..383
Zeta_toxin [PF06414], Evalue: 4.10E-06, Aligned region: 600..646
Zeta_toxin [PF06414], Evalue: 4.10E-06, Aligned region: 788..816
AAA_25 [PF13481], Evalue: 7.20E-06, Aligned region: 36..73
AAA_25 [PF13481], Evalue: 7.20E-06, Aligned region: 227..251
AAA_25 [PF13481], Evalue: 7.20E-06, Aligned region: 602..631
Sigma54_activat [PF00158], Evalue: 1.10E-05, Aligned region: 221..243
Sigma54_activat [PF00158], Evalue: 1.10E-05, Aligned region: 577..706
AAA_14 [PF13173], Evalue: 2.10E-05, Aligned region: 227..357
AAA_14 [PF13173], Evalue: 2.10E-05, Aligned region: 604..687
AAA_18 [PF13238], Evalue: 3.50E-05, Aligned region: 227..250
AAA_18 [PF13238], Evalue: 3.50E-05, Aligned region: 607..635
TIP49 [PF06068], Evalue: 5.00E-05, Aligned region: 227..248
TIP49 [PF06068], Evalue: 5.00E-05, Aligned region: 275..307
TIP49 [PF06068], Evalue: 5.00E-05, Aligned region: 572..641
AAA_29 [PF13555], Evalue: 0.00012, Aligned region: 219..243
AAA_29 [PF13555], Evalue: 0.00012, Aligned region: 602..631
NACHT [PF05729], Evalue: 0.0014, Aligned region: 227..254
NACHT [PF05729], Evalue: 0.0014, Aligned region: 606..631
RNA_helicase [PF00910], Evalue: 0.0017, Aligned region: 228..248
RNA_helicase [PF00910], Evalue: 0.0017, Aligned region: 607..628
NTPase_1 [PF03266], Evalue: 0.0018, Aligned region: 227..247
NTPase_1 [PF03266], Evalue: 0.0018, Aligned region: 606..628
AAA_33 [PF13671], Evalue: 0.0019, Aligned region: 228..246
AAA_33 [PF13671], Evalue: 0.0019, Aligned region: 605..627
AAA_33 [PF13671], Evalue: 0.0019, Aligned region: 789..841
AAA_11 [PF13086], Evalue: 0.0034, Aligned region: 226..501
AAA_11 [PF13086], Evalue: 0.0034, Aligned region: 597..657
RuvB_N [PF05496], Evalue: 0.0039, Aligned region: 226..246
RuvB_N [PF05496], Evalue: 0.0039, Aligned region: 298..307
RuvB_N [PF05496], Evalue: 0.0039, Aligned region: 567..627
ResIII [PF04851], Evalue: 0.0062, Aligned region: 216..241
ResIII [PF04851], Evalue: 0.0062, Aligned region: 298..309
ResIII [PF04851], Evalue: 0.0062, Aligned region: 578..628
DUF815 [PF05673], Evalue: 0.0093, Aligned region: 220..302
DUF815 [PF05673], Evalue: 0.0093, Aligned region: 559..643
Protein Sequence: 875 a.a.     [Download]
>gi|34499420|ref|NP_903635.1| ClpA/B-type chaperone [Chromobacterium violaceum ATCC 12472]
MKSLIDRLTPTARQAIEQAASRALARTHFEIEIEHVLLAMFDQDDNAALAALRALGADLGRVERELDAAL
DNFRSGNTRNPVLSSWLPKWLEKAWLLASAEHGQDSVSTLDLLLALWQDDALRGALQSGAPALARQDAGR
LSGAYAALRQHGGEAAGGEQPSAAADEGEGEAPAAPQGKRGGAALDKYTIDLTAQAKAGKIDPILGRDVE
IRQMIDILMRRRQNNPILTGEPGVGKTAVVEGLARKIVLGEVPPVLSGVTLRTLDLGLLQAGASVKGEFE
NRLRQVIDEVKASPVPIILFIDEAHTLIGAGGAAGQNDAANLLKPALARGELRTIAATTWAEYKKYFEKD
AALARRFQVVKVEEPAPEIAVQMVRGLTDAMAKHHKVEILNEAVAAAVQLSSRYIAGRQLPDKAISVLDT
ACARVALSRAGKPGPIEDVTVLIDNIDRETAALEREEGHAERIAELQAQRAKLEQDLAALHQAWEAQQKL
IEEIDELKAAKDEAKPAKGRKLSPLQAKRKELRELQKHQPLAFECVDESVIADVIAGWTGIPLGRMVSNE
LEQVQKLAKLLAERVIGQDHALEQIAERVQIAKANLEDPGKPKGVFLLVGPSGVGKTETALALAEALYGG
ERNLITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFD
KGVLEDSEGREVDFKNTIILLTSNAGTDLVMRACEHGVTVEDETRDPTAEDLVEILRPTLQKTFKPAFLG
RLTIVPYFPISDDVLRAIVGLKLDKIRRRIADNHGAQVEFPEELADQMAARCLDVDSGARNADAILTRTL
LAQISNDLLSRMASGKPVKKIAVALKGEQVKVKVS
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|34495455|ref|NC_005085.1|:c4289117-4286490 Chromobacterium violaceum ATCC 12472 chromosome, complete genome
CTGAAATCCCTGATAGACCGGTTGACGCCCACCGCGCGCCAGGCCATCGAGCAGGCCGCCAGCCGCGCGC
TGGCCCGCACCCACTTCGAGATCGAGATCGAGCATGTGCTGCTGGCGATGTTCGATCAGGACGACAATGC
CGCGCTGGCGGCGCTGCGCGCGCTGGGCGCGGACCTGGGCCGCGTCGAGCGCGAGCTGGACGCCGCGCTG
GACAACTTCCGCAGCGGCAATACCCGCAATCCGGTGCTGTCGTCGTGGCTGCCCAAGTGGCTGGAAAAGG
CCTGGCTGCTGGCCAGCGCCGAGCACGGCCAGGACAGTGTCTCCACGTTGGACTTGCTGCTGGCGCTGTG
GCAGGACGACGCCCTGCGCGGCGCGCTGCAGTCCGGCGCGCCGGCATTGGCGCGCCAGGATGCCGGCAGG
CTGTCCGGCGCCTACGCCGCGCTGCGCCAGCACGGCGGCGAGGCGGCGGGCGGCGAGCAGCCGTCGGCCG
CGGCAGACGAGGGCGAAGGCGAGGCGCCGGCCGCGCCGCAGGGCAAGCGCGGCGGCGCCGCGCTGGACAA
GTACACGATAGACCTGACCGCGCAGGCCAAGGCCGGCAAGATCGACCCCATCCTGGGCCGCGATGTCGAA
ATCCGCCAGATGATAGACATCCTGATGCGCCGCCGGCAGAACAATCCCATCCTCACCGGCGAGCCGGGCG
TGGGCAAGACCGCGGTGGTGGAAGGCTTGGCGCGCAAGATCGTGCTGGGCGAGGTGCCGCCGGTGCTGTC
CGGCGTCACGCTGCGCACGCTGGACCTGGGCCTGCTGCAGGCCGGCGCCAGCGTCAAGGGCGAGTTCGAG
AACCGCCTGCGCCAGGTGATAGACGAGGTCAAGGCCAGCCCGGTGCCCATCATCCTGTTCATCGACGAGG
CGCACACCCTGATCGGCGCCGGCGGCGCGGCCGGCCAGAACGACGCGGCCAACCTGCTGAAACCGGCGCT
GGCGCGCGGCGAGCTGCGCACCATCGCGGCGACGACCTGGGCCGAGTACAAGAAGTATTTCGAGAAGGAC
GCCGCGCTGGCGCGCCGCTTCCAGGTGGTGAAGGTCGAAGAGCCGGCGCCGGAAATCGCCGTGCAGATGG
TGCGCGGCCTGACCGACGCGATGGCCAAGCACCACAAGGTGGAAATCCTCAACGAGGCGGTGGCCGCCGC
AGTGCAGCTGTCCAGCCGCTACATCGCCGGCCGCCAGCTGCCGGACAAGGCGATCAGCGTGCTCGACACC
GCTTGCGCCCGCGTCGCGCTGTCGCGCGCCGGCAAGCCGGGGCCGATCGAGGACGTGACGGTGCTGATAG
ACAACATCGACCGCGAAACCGCCGCGCTGGAGCGCGAGGAAGGCCACGCCGAGCGCATCGCCGAGCTGCA
GGCGCAGCGCGCCAAGCTGGAGCAGGATCTGGCCGCGCTGCATCAGGCCTGGGAGGCGCAGCAGAAGCTG
ATCGAAGAGATAGACGAGCTGAAGGCGGCCAAGGACGAGGCCAAGCCGGCCAAGGGCAGGAAGCTCAGCC
CGCTGCAGGCCAAGCGCAAGGAATTGCGCGAGTTGCAGAAGCATCAGCCGCTGGCGTTCGAATGCGTGGA
CGAGAGCGTGATCGCCGACGTGATCGCCGGCTGGACCGGCATCCCGCTGGGCCGCATGGTCAGCAACGAG
CTGGAGCAGGTGCAGAAGCTGGCCAAGCTGCTGGCCGAGCGCGTGATCGGCCAGGACCACGCGTTGGAGC
AGATCGCCGAGCGGGTGCAGATCGCCAAGGCCAATCTGGAAGATCCCGGCAAGCCCAAGGGCGTATTCCT
GCTGGTGGGCCCGTCCGGCGTCGGCAAGACCGAGACCGCGCTGGCGCTGGCCGAGGCGCTGTACGGCGGC
GAGCGCAATCTGATCACCATCAACATGTCCGAATACCAGGAAGCGCACAGCGTGTCCGGCCTGAAGGGCT
CGCCCCCGGGTTATGTCGGCTACGGCGAGGGCGGCGTGCTGACCGAGGCGGTGCGCCGCAAGCCGTACTC
CGTCGTGCTGCTGGATGAAGTGGAGAAGGCGCACCCGGACGTGCTGGAGCTGTTCTTTCAGGTATTCGAC
AAGGGCGTGCTGGAGGATAGCGAAGGCCGCGAGGTGGACTTCAAGAACACCATCATCCTGCTGACGTCCA
ACGCCGGCACCGATCTGGTGATGCGCGCCTGCGAGCACGGCGTGACGGTGGAGGACGAGACCCGCGACCC
GACCGCGGAAGACCTGGTGGAAATCCTGCGCCCGACGCTGCAGAAGACCTTCAAGCCGGCTTTCCTCGGC
CGCCTGACCATCGTGCCTTACTTCCCGATCAGCGACGACGTGCTGCGCGCCATCGTCGGCCTGAAGCTGG
ACAAGATCCGCCGCCGCATCGCCGACAACCACGGCGCCCAGGTCGAGTTCCCGGAAGAACTGGCCGATCA
GATGGCCGCGCGCTGCCTGGACGTGGACAGCGGCGCGCGCAACGCCGACGCCATCCTCACCCGCACGCTG
CTGGCGCAGATCTCCAACGACCTGCTGTCGCGTATGGCCAGCGGCAAACCGGTGAAGAAGATCGCCGTCG
CGCTGAAGGGCGAGCAGGTCAAGGTGAAGGTGAGTTAA