SecReT6
Protein ID: 34499422
SecReT6 ID49
T6SS typei4b
Gene symbol-
Locus tagCV_3967
StrainChromobacterium violaceum ATCC 12472
Repliconchromosome [GenBank: NC_005085] [Browse all T6SS(s) in this replicon]
Location [Strand]4289891..4290934 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ7NR18
KEGG IDcvi:CV_3967
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-88, Aligned region: 26..332
Protein Sequence: 347 a.a.     [Download]
>gi|34499422|ref|NP_903637.1| hypothetical protein CV_3967 [Chromobacterium violaceum ATCC 12472]
MQMSDAELAVTASSRQPRDLRHELAADASQFGFFQAARILGLSGARRPGARRGRLPERLRFRTLASLSFP
ASELTGYKPGTEEGDAADEMTISFLGLTGPSGALPTAYTELLLERRLRHRDDTMHAFFDLFSHRAASLFF
EAWCKYRSWIHVEAGERNGFTRNLLDLGGVGLSQLRQQMGPGAELDERMFVYYAGLLSQKPLSAQSLLTL
VEGFFGVDATLEQFVGQWLQVPEGEQSQLGMDGCELGLSAFAGERIWDRQTKLKLRLGPLRREQFNALQP
HAAGAQALRALMKFALGHGLAAEVCLVLDQRDVQPAVLGSATLSLGGDSWMGRPAGHPDDMRYTLLD
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|34495455|ref|NC_005085.1|:c4290934-4289891 Chromobacterium violaceum ATCC 12472 chromosome, complete genome
ATGCAGATGAGCGATGCTGAGTTGGCTGTTACGGCATCGTCGCGGCAGCCCCGCGACCTGCGGCACGAGC
TCGCGGCCGATGCCAGCCAGTTCGGTTTCTTCCAGGCCGCGCGCATACTCGGCTTGTCCGGCGCGCGCCG
GCCGGGCGCGCGGCGCGGGCGTTTGCCGGAGCGGCTGCGTTTTCGCACGCTGGCGTCCCTTTCCTTCCCG
GCCAGCGAGCTGACCGGCTACAAGCCGGGAACGGAAGAGGGCGACGCGGCGGACGAGATGACGATCAGCT
TCCTCGGCCTGACCGGGCCGAGCGGCGCGCTGCCCACCGCCTATACCGAGCTGCTGCTGGAGCGCCGCCT
GCGCCACCGCGACGACACCATGCACGCCTTCTTCGACCTGTTCAGCCACCGCGCCGCGTCGCTGTTCTTC
GAGGCCTGGTGCAAGTACCGCAGCTGGATCCATGTCGAGGCGGGCGAGCGGAATGGCTTCACCCGCAACC
TGCTGGATCTGGGCGGCGTCGGCCTATCCCAGCTGCGCCAGCAGATGGGGCCGGGCGCGGAGCTGGACGA
GCGGATGTTCGTCTACTACGCCGGCCTGCTCAGCCAGAAGCCGCTGTCGGCGCAGTCGCTGCTGACGCTG
GTGGAAGGGTTCTTCGGCGTCGACGCCACTTTGGAGCAGTTTGTCGGCCAATGGCTGCAGGTGCCCGAGG
GCGAGCAGAGCCAGTTGGGCATGGATGGCTGCGAGTTGGGATTGTCGGCCTTCGCCGGCGAGCGCATCTG
GGACCGCCAGACCAAGCTCAAGCTGCGGCTGGGGCCTTTGCGCCGAGAGCAGTTCAACGCGCTGCAGCCG
CACGCCGCCGGCGCCCAGGCGCTGCGCGCGCTGATGAAGTTCGCGCTGGGCCACGGCCTGGCCGCCGAAG
TATGCCTGGTGCTGGACCAGCGCGACGTGCAGCCGGCGGTGCTGGGGTCGGCCACGCTGAGCCTGGGGGG
AGACAGCTGGATGGGCCGGCCGGCGGGACACCCCGACGATATGCGTTACACCTTGCTGGACTGA