SecReT6
Protein ID: 34499424
SecReT6 ID49
T6SS typei4b
Gene symbol-
Locus tagCV_3969
StrainChromobacterium violaceum ATCC 12472
Repliconchromosome [GenBank: NC_005085] [Browse all T6SS(s) in this replicon]
Location [Strand]4291222..4293081 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ7NR16
KEGG IDcvi:CV_3969
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-206, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|34499424|ref|NP_903639.1| hypothetical protein CV_3969 [Chromobacterium violaceum ATCC 12472]
MLESLLPYYERELGHLRELSGEFARRYPKIAGRLQMEGDQCADPHTERLIEAFALLASRIHKKLDDDYPE
VAESFLDVLYPHYLQPIPSATIVQFECDPARPEIAKRYRVERGQPVHAPAINGVVCKFRSAYPVDLYPLS
LNSAKLELTSGSPYLRQLAPDAAALLTMEFQTHGGLALNSIGLTSLRFFLDGEPALMHLLYELLLSQVLR
IRVGDGSEDPSRSAVLPASAIRPVGFGRDEGMLEYDERSFMGYRLLTEYFCYPDKFLFVDIAELDKAAVR
LDGGKLVLQLVLGDYPDSERHHRLLTQLQAHHLKLGCAPIVNLFNQPGEPIRVSHQKAGYAVLADGRKQQ
AYEVIQIRRVVRVEKSGEGESSEEVPPFYATRHGSERQTPRFYWHASREGSPRAGDKGTDLELHLVDLQF
NAVRPAAEVLSLDLLCSNRDLPEQIPFGGSQAAQRTDFSLPGHSVVKRVRLLRKPSATQRSPLGRAVQWR
LISHLSLNYMSIVDSGVAALQEMLALYNLTGSPVNVRQIQGVVGIDSKPAVTRVSGRDFAGFVRGSEIRL
KLDADYYVGGSVYLFASVLERFFALYCAPNSFTRLRVETTQQDQEVAVWPARAGEALVI
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|34495455|ref|NC_005085.1|:c4293081-4291222 Chromobacterium violaceum ATCC 12472 chromosome, complete genome
ATGCTTGAATCCTTACTACCGTATTACGAACGCGAACTCGGCCACCTGCGGGAGCTGTCGGGCGAGTTCG
CGCGCCGCTATCCGAAGATCGCCGGCCGGCTGCAGATGGAAGGCGACCAGTGCGCCGACCCGCACACCGA
ACGGCTGATCGAAGCGTTCGCGCTGCTGGCTTCGCGCATCCACAAAAAGCTGGACGACGATTATCCCGAG
GTGGCGGAAAGCTTCCTGGATGTGCTGTATCCGCATTATCTGCAGCCGATTCCGTCGGCCACCATCGTCC
AGTTCGAGTGCGATCCGGCGCGGCCGGAGATCGCCAAGCGCTACCGCGTGGAGCGCGGCCAGCCGGTGCA
TGCGCCGGCGATCAACGGCGTGGTGTGCAAATTCCGCAGCGCCTACCCGGTGGACCTGTATCCGCTGTCG
CTGAATAGCGCCAAGCTGGAGCTGACCAGCGGCTCGCCCTATCTGCGCCAGTTGGCGCCGGACGCGGCGG
CGCTGCTGACGATGGAGTTCCAGACCCACGGCGGCCTGGCCTTGAACAGCATAGGGCTGACTTCGCTGCG
CTTCTTCCTGGACGGCGAGCCGGCGCTGATGCACCTGCTGTACGAGCTCCTGCTGTCCCAGGTGCTGCGC
ATCCGCGTCGGCGATGGCAGCGAGGACCCGTCGCGCAGCGCGGTGCTGCCGGCCTCGGCCATCCGCCCGG
TGGGCTTCGGCCGCGACGAGGGCATGCTGGAGTACGACGAGCGCTCGTTCATGGGCTACCGGCTGCTGAC
CGAATATTTCTGCTATCCGGACAAGTTCCTGTTCGTCGACATCGCCGAGCTGGACAAGGCCGCGGTGCGC
CTGGATGGCGGCAAGCTGGTGCTGCAGCTGGTGCTGGGCGACTACCCGGACAGCGAGCGCCATCACCGGC
TGTTGACCCAATTGCAAGCCCATCATCTGAAGCTGGGCTGCGCCCCCATCGTCAACCTGTTCAACCAGCC
CGGCGAGCCCATCCGCGTCAGCCACCAGAAGGCCGGCTACGCGGTGCTGGCCGACGGCCGCAAGCAGCAG
GCTTACGAAGTGATCCAGATCCGCCGCGTGGTGCGGGTGGAGAAGTCCGGCGAGGGCGAAAGCAGCGAGG
AGGTGCCGCCGTTCTATGCCACGCGCCACGGCAGCGAGCGCCAGACGCCGCGCTTCTACTGGCACGCCAG
CCGCGAAGGCTCGCCGCGAGCCGGTGACAAGGGAACGGACCTGGAACTGCATCTGGTGGATCTGCAGTTC
AACGCGGTGCGGCCGGCGGCCGAGGTGCTGAGCCTGGACTTGCTGTGCAGCAACCGCGACCTGCCGGAGC
AGATTCCCTTCGGCGGCAGCCAGGCGGCGCAGCGCACCGATTTCAGCCTGCCCGGCCATTCGGTGGTGAA
GCGGGTGAGGCTGCTGCGCAAGCCGTCGGCCACCCAGCGCAGCCCTTTGGGCCGCGCGGTGCAGTGGCGG
CTGATCTCGCATCTGTCGCTGAACTACATGTCCATCGTCGATTCCGGCGTGGCGGCGCTGCAGGAGATGC
TGGCGCTGTACAACCTCACTGGTTCGCCGGTCAACGTGCGCCAGATCCAGGGCGTGGTGGGCATAGACAG
CAAGCCGGCGGTGACGCGCGTCAGCGGCCGCGATTTCGCCGGCTTCGTCCGCGGCAGCGAAATCAGGCTG
AAACTGGACGCCGATTACTATGTCGGCGGCAGCGTCTACTTGTTCGCCTCGGTGCTGGAACGCTTCTTCG
CTTTGTACTGCGCGCCCAACAGCTTCACCCGGTTGCGGGTGGAGACGACGCAGCAGGACCAGGAGGTGGC
GGTATGGCCGGCGCGGGCGGGCGAGGCTTTGGTGATATGA