SecReT6
Protein ID: 34499433
SecReT6 ID49
T6SS typei4b
Gene symbol-
Locus tagCV_3978
StrainChromobacterium violaceum ATCC 12472
Repliconchromosome [GenBank: NC_005085] [Browse all T6SS(s) in this replicon]
Location [Strand]4301678..4303156 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ7NR07
KEGG IDcvi:CV_3978
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.00E-192, Aligned region: 65..488
DUF3386 [PF11866], Evalue: 3.30E-05, Aligned region: 46..124
DUF3386 [PF11866], Evalue: 3.30E-05, Aligned region: 131..148
Protein Sequence: 492 a.a.     [Download]
>gi|34499433|ref|NP_903648.1| hypothetical protein CV_3978 [Chromobacterium violaceum ATCC 12472]
MSAELQQQAAPAAAEGVSLLDSIIEQSRIATNESEKSHTRDLIGELVDQVLQGSVTVSRDLSASIDARIA
EIDKLISDQLNNVMHHAEFQKLEASWRGLNYLVMQSETSTQLKIKVLNASKKDLVKDFKAAAEFDQSALF
KKIYEEEYGTFGGAPYAALVGDYEFTRHPEDFYLLDELSHVAASAHAPLISSADPGLFGLESFADIGKPR
DLAKIFDTVEYAKWKSFRESEDSRYVGLVLPHVLGRLPYGRDNVPVEEFDFEENVDGSNHDKYLWTNAAY
AYAARLTDAFAQFGWLAAIRGVEGGGLVEGLPAHTFKTDDGEVALKCPTEVAITDRTEKLLSDLGFISLV
HCKNTDYAAFFGGQSAQKAKTYNTDSANANARLSTQLPYIFAVSRIAHYMKSIMRDKIGSFASRQNVQDY
LNTWLAQYVLLDDSASQEAKAKYPLREARVDVVEVPGKPGVYRAAAFLRPHFQLDELTISLRLVAELPQP
AG
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|34495455|ref|NC_005085.1|:c4303156-4301678 Chromobacterium violaceum ATCC 12472 chromosome, complete genome
GTGAGCGCGGAATTGCAACAACAGGCGGCGCCGGCCGCGGCGGAAGGCGTCAGCCTGCTCGACAGCATCA
TCGAGCAGAGCCGCATCGCCACCAATGAAAGCGAGAAAAGCCACACCCGCGACCTGATCGGCGAACTGGT
CGACCAGGTGCTGCAGGGCAGCGTCACCGTCTCGCGCGACCTGTCGGCCAGCATCGACGCCCGCATCGCC
GAGATCGACAAGCTGATCTCCGACCAGTTGAACAACGTGATGCACCACGCCGAGTTCCAGAAACTGGAAG
CTTCGTGGCGCGGCCTGAACTACCTGGTGATGCAGTCCGAAACCAGCACCCAGCTGAAGATCAAGGTGCT
GAACGCGTCCAAGAAGGACTTGGTCAAGGACTTCAAGGCTGCCGCCGAGTTTGACCAGAGCGCGCTGTTC
AAGAAAATCTACGAGGAAGAGTACGGCACCTTCGGCGGCGCGCCTTACGCCGCGCTGGTGGGCGACTACG
AATTCACCCGCCACCCGGAAGACTTCTACCTGCTGGACGAGCTGTCCCACGTGGCCGCCTCCGCCCACGC
GCCGCTGATCTCGTCGGCCGATCCGGGCTTGTTCGGCCTGGAAAGCTTCGCCGACATCGGCAAGCCGCGC
GATCTGGCGAAGATCTTCGACACCGTCGAGTACGCGAAGTGGAAGTCGTTCCGCGAATCGGAAGACTCCC
GCTACGTCGGCCTGGTGCTGCCGCATGTGCTGGGCCGCCTGCCGTACGGCCGCGACAATGTGCCGGTCGA
GGAATTCGATTTCGAGGAAAATGTCGACGGCAGCAACCACGACAAATACTTGTGGACCAACGCGGCTTAC
GCCTACGCCGCGCGCCTGACCGACGCCTTCGCCCAGTTCGGCTGGCTGGCGGCCATCCGCGGCGTGGAAG
GCGGCGGCCTGGTGGAAGGCCTGCCGGCCCACACCTTCAAGACCGACGACGGCGAAGTGGCGCTGAAGTG
CCCGACCGAGGTGGCGATCACCGACCGCACCGAGAAGCTGCTGTCCGACCTGGGCTTCATCTCGCTGGTG
CACTGCAAGAACACCGACTACGCGGCCTTCTTCGGCGGCCAGTCGGCGCAAAAGGCCAAGACCTACAACA
CCGACTCGGCCAACGCCAACGCGCGCCTGTCCACGCAGCTGCCGTACATCTTCGCGGTATCCCGCATCGC
GCATTACATGAAGTCCATCATGCGCGACAAGATCGGCAGCTTCGCTTCGCGCCAGAACGTCCAGGACTAC
CTGAACACCTGGCTGGCCCAGTACGTGCTGCTGGACGATTCCGCCAGCCAGGAAGCCAAGGCCAAGTACC
CGCTGCGCGAAGCGCGCGTCGACGTGGTGGAAGTGCCCGGCAAGCCGGGCGTCTACCGCGCCGCCGCTTT
CCTGCGCCCTCATTTCCAGCTCGACGAGCTGACGATTTCTTTGCGTCTGGTGGCCGAGCTGCCGCAACCG
GCGGGCTAA