SecReT6
Protein ID: 34499434
SecReT6 ID49
T6SS typei4b
Gene symbol-
Locus tagCV_3979
StrainChromobacterium violaceum ATCC 12472
Repliconchromosome [GenBank: NC_005085] [Browse all T6SS(s) in this replicon]
Location [Strand]4303153..4303659 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ7NR06
KEGG IDcvi:CV_3979
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-60, Aligned region: 10..162
Protein Sequence: 168 a.a.     [Download]
>gi|34499434|ref|NP_903649.1| hypothetical protein CV_3979 [Chromobacterium violaceum ATCC 12472]
MGKESTQKKLSRVRPPRVQITYDVEIGDAIETKELPFVLGVLGDYSGHSKEPLPKMKERKFVQIDRDNFD
EVLKGMAPRLAMKVDNALKDDGTQLGVELNFESLSDFEPQNVVRQIDPLNQLLEARTRLADLRNKLAGND
KLEELLDEVVRDTEKLRQIGGKKEGGEQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|34495455|ref|NC_005085.1|:c4303659-4303153 Chromobacterium violaceum ATCC 12472 chromosome, complete genome
ATGGGCAAGGAAAGCACTCAGAAAAAACTGTCGAGGGTCCGTCCGCCGCGCGTGCAGATCACCTATGACG
TCGAGATCGGCGACGCGATCGAAACCAAGGAGCTGCCGTTCGTGCTGGGCGTGCTGGGCGATTATTCCGG
CCACAGCAAGGAGCCGCTGCCGAAGATGAAGGAGCGCAAGTTCGTCCAGATCGACCGCGACAACTTCGAC
GAGGTGCTGAAGGGCATGGCGCCGCGCCTGGCGATGAAGGTGGACAACGCGCTGAAGGACGACGGCACCC
AGCTGGGCGTGGAATTGAATTTCGAGAGCCTGTCGGATTTCGAGCCGCAGAACGTGGTTCGCCAGATCGA
CCCGTTGAACCAGCTGCTGGAGGCCCGCACCCGCCTGGCCGATCTGCGCAATAAGCTGGCCGGCAACGAC
AAGCTCGAAGAGCTGCTGGACGAAGTGGTGCGCGATACCGAGAAGCTGCGCCAGATCGGCGGCAAGAAAG
AAGGAGGCGAGCAGTGA