SecReT6
Protein ID: 34499437
SecReT6 ID49
T6SS typei4b
Gene symbol-
Locus tagCV_3982
StrainChromobacterium violaceum ATCC 12472
Repliconchromosome [GenBank: NC_005085] [Browse all T6SS(s) in this replicon]
Location [Strand]4309554..4310102 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ7NR03
KEGG IDcvi:CV_3982
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-28, Aligned region: 29..154
Protein Sequence: 182 a.a.     [Download]
>gi|34499437|ref|NP_903652.1| hypothetical protein CV_3982 [Chromobacterium violaceum ATCC 12472]
MGVDYMDFTKHWQKTCMILAAAALPLLGGCWGPKNITLSTEASQMLNRDKHGKPLSVVVQVYQLKSDQEF
KLLTPDLLASGKPIENVLGSSVLSRKELLFVPGGKQEMDITIDDGANFVGVIGYFRQPNPQFWRLLYDAN
RVRSKDLKFKVADCYLQAIKPEALQLPDQPKSGAVECPASRN
 
Nucleotide Sequence: 549 bp     [Download]
>gi|34495455|ref|NC_005085.1|:4309554-4310102 Chromobacterium violaceum ATCC 12472 chromosome, complete genome
TTGGGTGTGGATTATATGGACTTCACTAAGCACTGGCAAAAAACTTGCATGATACTCGCAGCCGCAGCGC
TGCCGCTGCTCGGCGGCTGCTGGGGCCCGAAGAACATCACGCTCAGCACTGAAGCCAGCCAGATGTTGAA
CCGCGACAAACATGGAAAACCATTATCCGTCGTGGTCCAAGTTTACCAACTGAAATCCGATCAGGAATTC
AAATTACTCACACCTGACCTTTTGGCCAGTGGTAAACCAATCGAGAATGTGCTTGGCTCTTCCGTATTAT
CTCGCAAGGAGCTGTTATTCGTTCCTGGCGGTAAACAGGAAATGGATATCACGATTGACGACGGCGCTAA
TTTCGTCGGTGTGATCGGATATTTCCGACAGCCCAATCCGCAGTTCTGGCGCCTGCTTTACGACGCGAAT
CGCGTGCGCAGCAAAGACCTGAAATTCAAGGTCGCCGATTGCTATCTGCAGGCCATCAAGCCCGAAGCGC
TGCAGCTGCCCGACCAGCCCAAGAGCGGCGCGGTCGAGTGTCCGGCTTCGCGCAACTGA