SecReT6
Protein ID: 34499438
SecReT6 ID49
T6SS typei4b
Gene symbol-
Locus tagCV_3983
StrainChromobacterium violaceum ATCC 12472
Repliconchromosome [GenBank: NC_005085] [Browse all T6SS(s) in this replicon]
Location [Strand]4310149..4311495 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ7NR02
KEGG IDcvi:CV_3983
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.40E-126, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|34499438|ref|NP_903653.1| hypothetical protein CV_3983 [Chromobacterium violaceum ATCC 12472]
MLQAQRILWGEGMFLRPQHFQQHALFQEQTQASLLHLTHRHAWGVQRLALDEAALKGGIVRVDELTLLFR
DGTLLQAPSHAPLPLSRDLASMPQVGVKTTLYACLAQLQPYGGNTRNGEASARPTRFHSDHREVSDLYTQ
ALAADLSTLQLDVKLMLEEENRDGHDAIPLCQLEKDATGQWGVGREFLPPLLAIEGSTELMQMLRRLLDI
LLVKSQSLAGAHRERAKSVMEFGSADISSFWLLHTVNRNFARLRHLSQSQPLHPEELYMALSEFCGELQT
FTTLYTLSDIPAYRHDGLHEVFPPLDLQIRELLETVVSARYKVIPLHSPRPSFHIGRLESDRLLENVDFY
LSVQSDQPASYVIDNVPLKLKIGAPDDVERILNSAMRGVSLAHSAQTPSAIPVRVGNHYFALEPGSEIYS
RMLQSRSVCIYIPQTLANISIELIAVFR
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|34495455|ref|NC_005085.1|:4310149-4311495 Chromobacterium violaceum ATCC 12472 chromosome, complete genome
ATGCTTCAAGCACAGAGAATCCTATGGGGCGAAGGCATGTTTCTTCGCCCGCAACATTTCCAGCAGCACG
CGCTGTTCCAGGAACAGACCCAGGCCAGCCTGCTGCATCTGACCCACCGCCACGCCTGGGGCGTGCAGCG
ATTGGCGCTTGACGAGGCCGCGCTGAAGGGCGGCATCGTCCGCGTCGACGAACTGACGCTGCTGTTCCGC
GACGGCACGCTGCTACAGGCGCCCTCCCACGCGCCGCTGCCGCTGAGCCGCGACCTGGCCTCCATGCCTC
AGGTCGGCGTGAAGACCACGCTATACGCCTGCCTGGCGCAGTTGCAGCCTTATGGCGGCAATACCCGCAA
TGGCGAGGCCAGCGCCCGCCCCACTCGCTTCCACAGCGACCATCGCGAAGTGTCCGACCTGTACACCCAG
GCGCTTGCGGCCGATCTGTCGACGCTGCAGCTGGACGTCAAGCTGATGCTGGAGGAGGAAAACCGCGACG
GCCACGACGCCATCCCGCTGTGCCAGCTGGAGAAGGACGCCACCGGCCAATGGGGCGTGGGCCGCGAATT
CCTGCCGCCGCTGCTGGCCATCGAGGGCTCGACCGAGCTGATGCAGATGCTGCGCCGCCTGCTGGACATC
CTGCTGGTGAAAAGCCAGTCGCTGGCCGGCGCCCACCGCGAGCGCGCCAAGAGCGTGATGGAATTCGGCT
CCGCCGACATCAGCTCCTTCTGGCTGCTGCACACGGTCAACCGCAATTTCGCGCGCCTGCGCCACCTGTC
GCAGTCCCAGCCGCTGCATCCGGAAGAGCTGTACATGGCGCTGTCCGAGTTCTGCGGCGAACTGCAGACC
TTCACCACGCTGTACACGCTGTCCGATATTCCGGCCTACCGCCACGACGGGCTGCACGAGGTGTTCCCGC
CGCTGGACCTGCAGATACGCGAGCTGCTGGAAACCGTGGTTTCGGCGCGCTACAAGGTGATTCCGCTGCA
CTCTCCGCGGCCGTCCTTCCACATCGGCCGCCTGGAAAGCGACCGCTTGCTGGAGAACGTGGATTTCTAC
CTGTCGGTGCAGAGCGACCAGCCCGCCAGCTACGTCATCGACAACGTGCCGCTCAAACTCAAGATCGGCG
CGCCGGACGACGTGGAGCGCATCCTCAACTCGGCGATGCGCGGCGTCAGCCTGGCGCACTCGGCCCAGAC
GCCGTCCGCCATCCCGGTGCGGGTGGGCAACCACTACTTCGCGCTGGAACCGGGCAGCGAGATCTACAGC
CGCATGCTGCAATCGCGCAGCGTCTGCATCTACATCCCGCAAACCCTGGCCAATATTTCGATAGAACTGA
TCGCGGTCTTCCGCTGA