SecReT6
Protein ID: 34499439
SecReT6 ID49
T6SS typei4b
Gene symbol-
Locus tagCV_3984
StrainChromobacterium violaceum ATCC 12472
Repliconchromosome [GenBank: NC_005085] [Browse all T6SS(s) in this replicon]
Location [Strand]4311503..4312204 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ7NR01
KEGG IDcvi:CV_3984
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-56, Aligned region: 23..223
Protein Sequence: 233 a.a.     [Download]
>gi|34499439|ref|NP_903654.1| hypothetical protein CV_3984 [Chromobacterium violaceum ATCC 12472]
MNQASTQTPERAITVSAPAAPAMREMLEDGIYLLFLLKEGNAPSSAVEFNRRVDHFLGQFERNARNFNKD
NNAISHAKYAFCALMDEIILSSDFALRDEWERMPLQLRLFGEHLAGEGFFNRLEQLRNHPAENIEPLEVF
YTCLLLGFQGKYLLEGQEKLGYLTHKLGQEIQQVRGGKADFAPNWQLPQRFQAFVRHELPLWLYFALLAI
VGAGIFVAFRWLLARQAASAFGL
 
Nucleotide Sequence: 702 bp     [Download]
>gi|34495455|ref|NC_005085.1|:4311503-4312204 Chromobacterium violaceum ATCC 12472 chromosome, complete genome
ATGAACCAAGCAAGCACCCAAACCCCCGAACGCGCGATCACCGTCTCCGCTCCGGCGGCGCCGGCCATGC
GCGAGATGCTGGAAGACGGCATCTACCTGCTGTTCCTGCTGAAGGAAGGCAACGCGCCGAGCAGCGCGGT
GGAATTCAACCGCCGCGTCGACCACTTCCTCGGCCAGTTCGAGCGCAACGCGCGCAACTTCAACAAGGAC
AACAACGCCATCAGCCATGCCAAATACGCATTCTGCGCGCTGATGGACGAGATCATCCTGTCCTCGGATT
TCGCGCTGCGCGACGAGTGGGAACGCATGCCACTGCAGCTGCGCCTGTTCGGCGAGCATCTGGCCGGCGA
AGGCTTCTTCAACCGCCTGGAGCAGCTGCGCAACCATCCGGCCGAAAACATCGAGCCGCTGGAAGTGTTC
TACACCTGCCTGCTGCTGGGCTTCCAGGGCAAGTACCTGCTGGAAGGCCAGGAAAAACTGGGCTACCTGA
CCCACAAGCTGGGCCAGGAAATCCAGCAGGTGCGCGGCGGCAAGGCCGATTTCGCGCCCAACTGGCAGCT
GCCGCAGCGCTTCCAGGCCTTCGTCCGCCACGAGCTGCCGCTGTGGCTGTACTTCGCGCTATTGGCCATC
GTCGGCGCCGGCATCTTCGTCGCCTTCCGCTGGCTGCTGGCGCGTCAGGCGGCCTCCGCGTTCGGGCTAT
GA