SecReT6
Protein ID: 34499440
SecReT6 ID49
T6SS typei4b
Gene symbol-
Locus tagCV_3985
StrainChromobacterium violaceum ATCC 12472
Repliconchromosome [GenBank: NC_005085] [Browse all T6SS(s) in this replicon]
Location [Strand]4312201..4312680 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ7NR00
KEGG IDcvi:CV_3985
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.80E-21, Aligned region: 38..140
Protein Sequence: 159 a.a.     [Download]
>gi|34499440|ref|NP_903655.1| hypothetical protein CV_3985 [Chromobacterium violaceum ATCC 12472]
MSVARHTQILPSVLDRLLDDEPDQSHIESISLFELPQFKRALARDLEALLNTRLMPLDELMESFPQARDS
LLTFGIPDLSGISLLNPDDRELLREQLRRSIELHEPRLSRVRVNLDAPREMERHLRFRVDAVLKVHPHRP
PVTFDATLQLSSNVYKVQG
 
Nucleotide Sequence: 480 bp     [Download]
>gi|34495455|ref|NC_005085.1|:4312201-4312680 Chromobacterium violaceum ATCC 12472 chromosome, complete genome
ATGAGCGTCGCCCGCCACACCCAGATACTGCCCTCGGTGCTGGATCGGTTGCTGGACGACGAGCCGGACC
AGAGCCACATCGAGTCGATCAGCCTGTTTGAACTGCCCCAGTTCAAGCGGGCGCTGGCGCGCGACCTGGA
AGCGCTGCTCAACACCCGGCTGATGCCGCTGGACGAGTTGATGGAGTCCTTCCCCCAGGCGCGCGACAGC
CTGCTCACGTTCGGCATCCCGGACCTGTCCGGCATCAGCCTGCTCAACCCGGACGACCGAGAGCTGTTGC
GCGAACAGCTGCGCCGCTCGATCGAGCTGCATGAGCCGCGGCTGTCGCGCGTGCGCGTCAATCTCGACGC
CCCGCGCGAGATGGAGCGCCACCTGCGCTTCCGCGTCGACGCGGTGCTCAAGGTTCACCCGCACCGCCCG
CCGGTGACTTTCGACGCCACGCTGCAACTCTCTTCCAACGTTTACAAGGTGCAGGGCTAA