SecReT6
Protein ID: 34499441
SecReT6 ID49
T6SS typei4b
Gene symbol-
Locus tagCV_3986
StrainChromobacterium violaceum ATCC 12472
Repliconchromosome [GenBank: NC_005085] [Browse all T6SS(s) in this replicon]
Location [Strand]4312701..4315319 [+]
ProductVgr-like protein
NoteTssI
UniProt IDQ7NQZ9
KEGG IDcvi:CV_3986
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-67, Aligned region: 43..363
Phage_GPD [PF05954], Evalue: 3.30E-67, Aligned region: 595..625
DUF2345 [PF10106], Evalue: 2.40E-56, Aligned region: 684..840
T6SS_Vgr [PF13296], Evalue: 3.40E-37, Aligned region: 422..434
T6SS_Vgr [PF13296], Evalue: 3.40E-37, Aligned region: 528..636
Phage_base_V [PF04717], Evalue: 3.30E-25, Aligned region: 220..238
Phage_base_V [PF04717], Evalue: 3.30E-25, Aligned region: 411..511
Sarcoglycan_1 [PF04790], Evalue: 0.0079, Aligned region: 35..62
Sarcoglycan_1 [PF04790], Evalue: 0.0079, Aligned region: 763..806
Protein Sequence: 872 a.a.     [Download]
>gi|34499441|ref|NP_903656.1| Vgr-like protein [Chromobacterium violaceum ATCC 12472]
MDLTSLLSSFASAFTQDQRLLTLELGSGQVAAEQLLPQSLNGEEGVSQAYRYQLTCLSPDGAIELKTLLG
QAARIGIADAQGQETIRCGVVSQARLMGSDGGFAQYGLTIEPPIALLRHRKTSRVFQDLSVPDIVQQIVH
EHQAANPVFARAQSIEFKVGPAQPRSYCLQYREDDFSFIVRLLHEEGYAWRFEHVDGDSPQVKLVVFDDA
YSLPPAEVERVRFHRSDATEEEDGLTDWSAARQIVPGNVALATFDYQPVSTQHTGDSSQIDQGPGGQALQ
SSLQDYDPQGLYYAGDAEQLSHYARLRQQAHDLQAKTFEGAGSIRGLTAGQWFRLDDHPAHEADSHEQRE
FVVTGQTLQVRNNLPTDLQSILPTGDKADAPFRTRIQAQRRGIPLTPAYAGTEHAKPKSRGVQTATVVGP
AGEEVHTDQHGRIKVQFHWQRPDEHPTIGAALDDKSSCWLRVAMPSAGAGWGHQFIPRIGQEVLVDFIEG
DIDRPVITGVLYNGSHPTPDFSGAGSLPANKTLSGIKSKEHQGGGYNELLFDDTPGEVRAKLSSEPGKTQ
LNQGYLAHPRSNGKAQPRGDGFELRTDHHGAIRAAHGLLLTTEAQNGASGKQLAREHAQSQLDAALSLSQ
ALAETASGQLADTMETGPDEIGPDNAKAGKKTDGHLQHHADALKAWEAGSNTDKDGKTAKDQAGQQPLLV
LSAPAGIASLTEQSQTVSAGQNLNLIAQRDANHTTGRRWLHNVGQHISLFVAGVKDKVALKLIAAKGKVQ
VQAQSDAMELTADKDVTIMSCKERIVVNAKDEILLTAGGAYIRLKGGNIEVHAPGTVSVKAAQHKLSGPD
NMTIPMPVFPGKQFCLQCMLNAIKSGSPLAGQ
 
Nucleotide Sequence: 2619 bp     [Download]
>gi|34495455|ref|NC_005085.1|:4312701-4315319 Chromobacterium violaceum ATCC 12472 chromosome, complete genome
ATGGATCTGACCAGCTTACTTTCCTCCTTCGCCTCCGCCTTTACCCAGGACCAGCGCCTGCTCACCCTGG
AACTGGGCAGCGGACAGGTCGCCGCCGAGCAGCTGCTGCCGCAAAGCCTCAATGGCGAAGAGGGCGTGTC
CCAGGCCTACCGCTATCAACTCACCTGCCTCTCCCCCGACGGCGCCATCGAACTCAAGACCCTGCTCGGC
CAGGCCGCCCGCATCGGCATCGCCGACGCCCAGGGCCAGGAGACCATCCGCTGCGGCGTGGTCAGCCAGG
CCCGGCTGATGGGTTCCGACGGCGGCTTCGCCCAGTACGGCCTCACCATCGAGCCGCCGATCGCGCTGTT
GCGCCACCGCAAGACTTCGCGCGTGTTCCAGGACTTGAGCGTGCCGGACATCGTCCAGCAGATCGTCCAC
GAGCATCAGGCGGCCAACCCGGTGTTCGCCCGCGCGCAGAGCATCGAGTTCAAGGTCGGCCCGGCGCAGC
CGCGCAGCTATTGCCTGCAGTACCGCGAGGACGACTTCAGCTTCATCGTCCGCCTGCTGCACGAGGAGGG
TTACGCCTGGCGCTTCGAGCACGTGGACGGAGACAGCCCCCAGGTCAAGCTGGTGGTGTTCGACGACGCC
TACAGCCTGCCGCCGGCCGAGGTGGAGCGGGTGCGCTTCCACCGCAGCGACGCGACGGAAGAGGAAGACG
GCCTCACCGACTGGAGCGCCGCGCGCCAGATCGTGCCCGGCAACGTGGCGCTGGCCACCTTCGACTACCA
GCCGGTGTCCACCCAGCACACCGGCGACAGCAGCCAGATCGACCAGGGCCCGGGCGGCCAGGCGCTGCAG
TCCAGCCTGCAGGACTACGATCCGCAGGGCCTGTACTACGCCGGCGACGCCGAGCAGTTGAGCCACTACG
CCCGGCTGCGCCAGCAGGCGCACGACCTGCAGGCCAAGACCTTCGAAGGCGCCGGCTCCATCCGCGGCCT
GACCGCCGGCCAGTGGTTCCGCCTGGACGACCACCCGGCGCACGAGGCCGACAGCCACGAACAGCGCGAA
TTCGTCGTCACCGGCCAGACGCTGCAGGTGCGCAACAACCTGCCGACCGATCTGCAGTCCATCCTGCCGA
CGGGCGACAAAGCCGACGCCCCGTTCCGCACCCGCATCCAGGCCCAGCGCCGCGGCATCCCGCTGACCCC
GGCCTATGCCGGCACAGAACACGCCAAACCGAAATCGCGCGGCGTCCAGACCGCCACCGTGGTCGGCCCG
GCCGGCGAGGAAGTCCACACCGATCAACACGGCCGCATCAAGGTGCAATTCCACTGGCAGCGGCCGGACG
AACACCCGACCATCGGCGCCGCGCTGGACGACAAATCCTCCTGCTGGCTGCGCGTGGCGATGCCGTCGGC
CGGCGCCGGCTGGGGCCACCAGTTCATCCCGCGCATCGGCCAGGAAGTGCTGGTCGATTTCATCGAAGGC
GACATCGACCGGCCGGTGATCACCGGCGTCTTGTACAACGGCAGCCACCCCACGCCCGACTTCAGCGGCG
CCGGCAGCCTGCCGGCCAACAAGACCCTGTCCGGCATCAAGTCGAAAGAACACCAGGGCGGCGGCTACAA
CGAGCTGCTGTTCGACGACACCCCCGGCGAAGTGCGCGCCAAGCTGTCCAGCGAGCCGGGCAAGACCCAG
CTCAACCAGGGCTACCTCGCCCACCCGCGCAGCAACGGCAAGGCCCAGCCGCGCGGCGACGGCTTCGAGC
TCAGAACCGACCACCACGGCGCCATCCGCGCCGCCCACGGCCTGCTGCTCACCACCGAAGCGCAGAACGG
CGCGTCCGGCAAACAACTGGCGCGCGAGCACGCGCAAAGCCAGCTCGACGCCGCCTTGAGCCTATCGCAA
GCCTTGGCCGAAACCGCCAGCGGCCAGTTGGCCGACACCATGGAAACCGGGCCCGACGAAATCGGCCCGG
ACAACGCCAAGGCCGGCAAGAAAACCGACGGCCACCTGCAACACCACGCCGACGCGCTGAAGGCTTGGGA
AGCCGGCAGCAACACCGATAAGGACGGCAAAACCGCCAAGGACCAAGCCGGCCAGCAGCCGCTGCTGGTG
CTGTCCGCCCCAGCCGGCATCGCCAGCCTGACCGAACAAAGCCAGACCGTCTCCGCCGGCCAGAACCTGA
ACCTGATCGCCCAGCGCGACGCCAACCACACGACGGGTCGGCGCTGGCTGCACAACGTCGGCCAGCACAT
CAGCCTGTTTGTGGCCGGGGTGAAGGACAAGGTGGCGCTAAAGCTGATCGCGGCCAAGGGCAAGGTACAG
GTGCAGGCGCAGAGCGACGCGATGGAGCTGACGGCGGATAAGGATGTGACGATCATGTCCTGCAAGGAAC
GCATCGTCGTCAATGCCAAGGACGAGATTCTGTTGACCGCAGGCGGCGCTTATATCCGTCTCAAGGGCGG
CAATATCGAAGTGCACGCACCCGGCACCGTAAGCGTGAAAGCCGCCCAGCACAAGCTGAGCGGACCCGAC
AATATGACCATCCCGATGCCAGTTTTCCCAGGCAAGCAGTTCTGCTTGCAGTGCATGCTGAATGCGATCA
AATCCGGCTCGCCCTTAGCCGGCCAATAA