SecReT6
Protein ID: 345299085
SecReT6 ID457
T6SS typei2
Gene symbol-
Locus tagEntas_1919
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]2064431..2064928 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDG2SBX9
KEGG IDeas:Entas_1919
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.70E-51, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|345299085|ref|YP_004828443.1| type VI secretion protein [Enterobacter asburiae LF7a]
MADSFQNEVPKARINLKLDLHTGGASKKTELPLKLLVAGDFSNGRESAPLSERKKVTLNKNNFDAVLSDY
SPDVNLTVKNTLADDGSEDNISLTFQSMKDFTPEQVSRQIPQLKAMLSMRNLLRDLKANLLDNQAFRKEL
EKILLDPALSAELRSELSALAPKQP
 
Nucleotide Sequence: 498 bp     [Download]
>gi|345297184|ref|NC_015968.1|:2064431-2064928 Enterobacter asburiae LF7a chromosome, complete genome
ATGGCTGACAGTTTCCAGAATGAAGTACCGAAGGCACGTATTAATCTAAAACTTGACCTGCATACAGGGG
GAGCCAGCAAGAAAACGGAACTTCCCCTGAAATTACTGGTGGCAGGTGACTTCAGTAACGGTCGCGAGTC
CGCACCATTATCAGAGCGTAAAAAAGTTACTCTGAATAAAAACAACTTTGACGCAGTGCTTTCCGATTAT
TCCCCAGACGTAAACCTGACCGTTAAAAACACACTTGCTGATGACGGCAGCGAAGACAATATCAGTCTGA
CTTTCCAGAGCATGAAGGATTTCACTCCTGAACAGGTCTCCCGGCAAATACCTCAGCTGAAGGCCATGCT
TTCCATGCGCAATCTGCTTCGTGATTTAAAAGCGAACCTGCTTGATAACCAGGCTTTCCGTAAGGAACTG
GAAAAGATTCTGCTCGACCCTGCGTTAAGCGCAGAACTTCGCTCAGAGCTGTCTGCCCTGGCCCCGAAAC
AGCCATAA