SecReT6
Protein ID: 345299086
SecReT6 ID457
T6SS typei2
Gene symbol-
Locus tagEntas_1920
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]2064968..2066509 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDG2SBY0
KEGG IDeas:Entas_1920
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.40E-175, Aligned region: 87..509
Protein Sequence: 513 a.a.     [Download]
>gi|345299086|ref|YP_004828444.1| EvpB family type VI secretion protein [Enterobacter asburiae LF7a]
MSVKNENAAGGESVVLERPAAGGVYASLFEKINLNPVSELSALDIWQDAQAMSDATADERLTAGMQVFLE
CLTKSGSKIEKLDKTLIDHHIAELDYQISRQLDAVMHSEEFQAVESLWRGVKSLVDKTDFRQNVKIELLD
MSKEDLRQDFEDSPEIIQSGLYKHTYIDEYDTPGGEPIAALISAYEFDASAQDVALLRNISKVSAAAHMP
FIGSAGPKFFLKDSMEDVAAIKDIGNYFDRAEYIKWKSFRETDDARYIGLVMPRVLGRLPYGPDTVPVRS
FNYVEEVKGPDHDKYLWTNASFAFASNMVKSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSTQKPALYDTADATANSRINARLPYIFLLSRIAHY
LKLIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVKLYAI
PHFQVEGMDVNLSLVSQMPKAKS
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|345297184|ref|NC_015968.1|:2064968-2066509 Enterobacter asburiae LF7a chromosome, complete genome
ATGTCTGTAAAAAATGAAAATGCTGCGGGTGGTGAGAGTGTGGTGCTGGAACGTCCTGCAGCAGGTGGCG
TTTATGCGTCCCTGTTTGAAAAAATCAACCTGAACCCGGTGTCCGAGCTGAGTGCGCTGGATATCTGGCA
GGATGCACAGGCGATGTCGGATGCGACTGCAGATGAACGTTTAACGGCGGGGATGCAGGTGTTCCTTGAG
TGCCTGACAAAATCGGGCTCCAAAATTGAAAAACTCGATAAAACGCTGATTGATCACCATATCGCGGAGT
TGGACTATCAGATTAGCCGTCAGCTGGATGCGGTCATGCACAGTGAAGAATTCCAGGCGGTAGAAAGTCT
GTGGCGTGGCGTGAAATCGCTGGTCGACAAAACCGATTTCCGCCAGAACGTGAAGATTGAGCTGCTGGAC
ATGTCCAAAGAAGACCTGCGTCAGGACTTCGAAGACAGCCCGGAAATCATCCAGAGTGGACTGTATAAAC
ATACCTATATCGATGAGTATGACACCCCGGGGGGAGAGCCGATCGCCGCGCTGATTTCGGCCTATGAGTT
TGATGCGTCTGCGCAGGATGTCGCGTTGTTGCGCAATATCTCTAAAGTGTCTGCCGCAGCGCACATGCCG
TTTATCGGCTCTGCCGGCCCGAAATTCTTCCTGAAGGACTCAATGGAGGATGTGGCGGCCATCAAGGATA
TCGGTAACTATTTTGACCGTGCGGAATACATCAAGTGGAAATCTTTCCGTGAGACGGACGATGCCCGTTA
TATCGGTCTGGTGATGCCGCGAGTGTTGGGTCGTCTGCCGTATGGCCCGGACACCGTACCGGTGCGTAGC
TTCAATTATGTCGAAGAAGTGAAAGGTCCGGATCATGACAAATACCTGTGGACCAACGCCTCATTTGCCT
TTGCATCCAACATGGTGAAGAGCTTTATCAATAACGGCTGGTGTGTACAAATCCGTGGCCCGCAGGCCGG
TGGTGCCGTCCAGGATTTGCCTATCCATCTGTACGATCTGGGTACCGGTAATCAGGTAAAAATCCCGAGT
GAAGTGATGATCCCGGAAACCCGCGAATTTGAATTTGCCAACCTGGGCTTCATTCCCCTGTCGTACTACA
AAAACCGCGACTACGCCTGCTTTTTCTCGGCAAACTCGACCCAGAAACCAGCCCTGTATGATACCGCCGA
TGCAACGGCCAACAGCCGTATCAATGCGCGTCTTCCCTACATCTTCCTGCTGTCACGTATTGCACACTAC
CTGAAGCTGATTCAGCGTGAAAACATCGGTACCACTAAAGATCGTCGCCTGCTGGAGCTGGAGCTGAACA
CCTGGGTTCGCAGTCTGGTGACGGAAATGACCGACCCGGGCGATGAGTTGCAGGCCTCTCACCCACTGCG
CGACGCCAAAGTGGTGGTGGAAGACATCGAAGACAACCCGGGATTCTTCCGTGTGAAACTGTATGCGATC
CCGCACTTCCAGGTGGAAGGGATGGACGTCAATCTGTCACTGGTCTCTCAGATGCCGAAGGCGAAATCAT
AA