SecReT6
Protein ID: 345299087
SecReT6 ID457
T6SS typei2
Gene symbol-
Locus tagEntas_1921
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]2066527..2067867 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDG2SBY1
KEGG IDeas:Entas_1921
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.90E-136, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|345299087|ref|YP_004828445.1| type VI secretion protein [Enterobacter asburiae LF7a]
MKTEQPLWGRGVMVSPQHFQQQAAYAAWSAECIARLGLSHPWGMIEAIFEPDALKMGRLQARHLHIRFPD
GTLIDTDNADDLPPVLALEGESQEVVVVLALPLLRANGGNCLKPDEVAERPVRFRQRWRDVRNTFGEDTR
QIAVMRPELTLRFAHQNNSDYLTCPVARLQQDSQGTWLLDETFLPPLLTIQGSRWLVTQLEQLMTQLRAR
LSRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGQFLRHPQSPPERLYPELARLAGSLLTFSLE
HQVSAIPVWQHEQLNNVFPPLFELLGDLLEASLPSRVVAIELEHDARLHFWQARLHDPRLRKGADYYLSI
RSSIPVAQLQEQVPRQCKVGSPDHVRSIVNSSRVGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEML
QSGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|345297184|ref|NC_015968.1|:2066527-2067867 Enterobacter asburiae LF7a chromosome, complete genome
ATGAAAACGGAACAACCGTTATGGGGTAGGGGCGTGATGGTCTCTCCCCAGCACTTCCAGCAACAGGCCG
CGTATGCGGCCTGGTCTGCGGAATGCATTGCCCGACTGGGTCTCTCCCATCCCTGGGGAATGATTGAGGC
CATTTTCGAACCGGATGCACTGAAAATGGGCCGCCTGCAGGCCCGTCATCTGCACATCCGTTTTCCCGAT
GGCACGCTTATCGACACGGATAATGCTGACGACCTGCCGCCGGTGCTGGCGCTTGAGGGCGAATCGCAGG
AAGTGGTGGTGGTCCTGGCCCTTCCGTTGCTTCGGGCGAATGGCGGCAACTGCCTTAAACCCGATGAGGT
GGCTGAACGCCCGGTACGTTTCCGTCAGCGCTGGCGGGATGTCCGCAATACCTTCGGAGAAGATACCCGT
CAGATTGCTGTAATGCGCCCGGAGTTGACGTTGCGGTTTGCACATCAGAATAACAGCGATTACCTGACCT
GCCCGGTCGCCCGCCTGCAGCAGGATTCGCAGGGGACGTGGTTACTGGATGAAACATTTCTCCCCCCGCT
CCTTACCATCCAGGGCAGTCGCTGGCTGGTGACCCAGTTGGAACAGCTGATGACACAGCTGCGTGCCCGT
CTGAGCCGCCTGATGGCCATGCGTCGTGAAAGTAACGAACGCATGGCCGATTTTGCCGTGGCTGATGTGT
CACTGTTCTGGTTGCTCAATGCCCTAAACAGCGCAGAACCCGTGCTCGGACAGTTCCTGCGCCACCCGCA
AAGTCCGCCTGAGCGTCTGTATCCGGAGTTGGCACGCCTTGCGGGCAGCCTGCTGACCTTCTCACTGGAA
CACCAGGTGAGTGCTATTCCGGTCTGGCAACATGAGCAACTGAATAATGTCTTCCCGCCGTTGTTTGAAT
TACTGGGCGACCTGCTGGAAGCCAGCCTGCCGTCGCGGGTGGTCGCTATTGAGCTTGAGCATGATGCGCG
GCTGCACTTCTGGCAGGCTCGTCTGCATGACCCACGTCTGCGTAAAGGGGCAGATTACTACCTTTCCATA
CGTTCATCGATTCCGGTGGCGCAACTTCAGGAGCAGGTCCCGCGCCAGTGCAAGGTCGGCAGCCCCGATC
ATGTCAGGAGTATCGTCAATTCATCACGGGTGGGGGTGCCTCTGACGCCGCTGCGCCATGTGCCGGCCGC
CATTCCACTGCGTCTGGAAAACCAGTATTTCAGCCTCGATGTCTCTCATCCTCTGGCAACCGAAATGCTT
CAGAGCGGCACCTGTATGTTTTACGTGCCGGGGATGCTCGGCGAGCCGGAACTTGAACTCTTTGCGGTAC
TGAGAACATGA